Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9r8a
Status:HPUB -- hold until publication
Title:PHF tau filament from the brain of a football player
Authors:Qi, C., Scheres, H.W.S., Goedert, M.
Deposition date:2025-05-16
PDBID:9r8d
Status:HPUB -- hold until publication
Title:SF tau filament from the brain of a football player
Authors:Qi, C., Scheres, H.W.S., Goedert, M.
Deposition date:2025-05-16
PDBID:9oov
Status:HOLD -- hold until a certain date
Title:Cryo-EM structure of the heterotrimeric complex formed by two subunits of YrvO and a subunit of MnmA bound to tRNA-Glu
Authors:Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H.
Deposition date:2025-05-16
Release date:2025-11-16
PDBID:9oow
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the heterotetrameric complex formed by two subunits of YrvO and two subunits of MnmA bound to tRNA-Glu
Authors:Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H.
Deposition date:2025-05-16
PDBID:9uz7
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the nucleosome core particle with site-specific DNA-histone crosslinking
Authors:Zhou, C.Z., Li, H.T., Shan, X.J., Ji, G.Y.
Deposition date:2025-05-16
PDBID:9r82
Status:HPUB -- hold until publication
Title:6-Helix Bundle - with a Clasp (6HB-C)-monomer with 2''-Fluoro-modified pyrimidines (FY RNA)
Authors:Kristoffersen, E.L., Andersen, E.S., Zwergius, N.H.
Deposition date:2025-05-15
PDBID:9onh
Status:HPUB -- hold until publication
Title:Structure of ancestral-reconstructed cytochrome P450 11A1 (CYP11A1) in complex with desmosterol
Authors:Alves Chagas, B.C., Brixius-Anderko, S.
Deposition date:2025-05-15
PDBID:9oo5
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the dimeric YrvO cysteine desulfurase
Authors:Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H.
Deposition date:2025-05-15
PDBID:9uyb
Status:HOLD -- hold until a certain date
Title:Crystal structure of ZER1 bound to GSER degron
Authors:Dong, C., Li, J., Zhang, B.
Deposition date:2025-05-15
Release date:2026-05-15
PDBID:9ont
Status:HOLD -- hold until a certain date
Title:Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol hexakisphosphate
Authors:Cleland, C.P., Mosimann, S.C.
Deposition date:2025-05-15
Release date:2025-11-15
PDBID:9onu
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol-(1,2,4,5,6)-pentakisphosphate
Authors:Cleland, C.P., Mosimann, S.C.
Deposition date:2025-05-15
Release date:2025-11-15
PDBID:9uyv
Status:HPUB -- hold until publication
Title:Crystal Structure of VPS25 from Candidatus Prometheoarchaeum syntrophicum strain MK-D1
Authors:Robinson, R.C., Naripogu, K.B.
Deposition date:2025-05-15
PDBID:9r7k
Status:HPUB -- hold until publication
Title:De novo designed enzyme for the Morita-Baylis-Hillman reaction (MBH61)
Authors:Tripp, A., Bijelic, A., Fischer, C., Moser, M., Oberdorfer, G.
Deposition date:2025-05-14
PDBID:9om5
Status:HPUB -- hold until publication
Title:Composite map of six VRC35 Fabs and three MEDI8852 Fabs bound to influenza H3N2 Victoria 2011 hemagglutinin
Authors:Cheng, J., Cale, E.M., Longo, N., Sutton, M.S., Lei, H., Huang, R., Morton, A.J., Lang, Z.C., Morano, N.C., Roark, R.S., Becker, J.E., Tsybovsky, Y., Li, N., Zhang, B., Du, H., Rubin, S., Shapiro, L., Pierson, T.C., Doria-Rose, N.A., Kwong, P.D., Zhou, T.
Deposition date:2025-05-13
PDBID:9om1
Status:HPUB -- hold until publication
Title:Full length LRRK2 active form 1 (class6)
Authors:Villagran-Suarez, A.C.
Deposition date:2025-05-13
PDBID:9om2
Status:HPUB -- hold until publication
Title:Full-length LRRK2 autoinhibited
Authors:Villagran-Suarez, A.C., Bodrug, T.
Deposition date:2025-05-13
PDBID:9r6i
Status:HPUB -- hold until publication
Title:Crystal structure of PPARgamma in complex with the bisphenol derivative BPS4BE
Authors:Carivenc, C., Bourguet, W.
Deposition date:2025-05-12
Sequence:

>Entity 1


GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
PDBID:9r6k
Status:HPUB -- hold until publication
Title:Crystal structure of PPARgamma in complex with the bisphenol derivative BPPH
Authors:Carivenc, C., Bourguet, W.
Deposition date:2025-05-12
Sequence:

>Entity 1


GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
PDBID:9okw
Status:HPUB -- hold until publication
Title:16mer self-complementary duplex RNA with dG:C pair sequence 1
Authors:Fang, Z., Szostak, J.W.
Deposition date:2025-05-11
PDBID:9okz
Status:HOLD -- hold until a certain date
Title:16mer self-complementary duplex RNA with dG:s(2)C pair sequence 2
Authors:Fang, Z., Szostak, J.W.
Deposition date:2025-05-11
Release date:2026-05-11
PDBID:9okx
Status:HPUB -- hold until publication
Title:16mer self-complementary duplex RNA with dG:C pair sequence 2
Authors:Fang, Z., Szostak, J.W.
Deposition date:2025-05-11
PDBID:9oky
Status:HPUB -- hold until publication
Title:16mer self-complementary duplex RNA with dG:s(2)C pair sequence 1
Authors:Fang, Z., Szostak, J.W.
Deposition date:2025-05-11
PDBID:9ol0
Status:HPUB -- hold until publication
Title:16mer self-complementary duplex RNA with dI:s(2)C pair sequence 1
Authors:Fang, Z., Szostak, J.W.
Deposition date:2025-05-11
PDBID:9ol1
Status:HPUB -- hold until publication
Title:16mer self-complementary duplex RNA with dI:s(2)C pair sequence 2
Authors:Fang, Z., Szostak, J.W.
Deposition date:2025-05-11
PDBID:9r5x
Status:HPUB -- hold until publication
Title:Aliphatic Amidase Variant T103I
Authors:Salgueiro, B.A., Karmali, A., Frazao, C.
Deposition date:2025-05-10

242842

PDB entries from 2025-10-08

PDB statisticsPDBj update infoContact PDBjnumon