PDBID: | 8xjc | Status: | HPUB -- hold until publication | Title: | a novel haemophore of of Riemerella anatipestifer | Authors: | Zhang, D.D., Chen, T.T. | Deposition date: | 2023-12-21 |
|
PDBID: | 8xiv | Status: | HPUB -- hold until publication | Title: | Production of D-psicose | Authors: | Guo, D. | Deposition date: | 2023-12-20 |
|
PDBID: | 8xix | Status: | HPUB -- hold until publication | Title: | KeDt3e within Co | Authors: | Guo, D. | Deposition date: | 2023-12-20 |
|
PDBID: | 8xj1 | Status: | HPUB -- hold until publication | Title: | Apo-KeDt3e | Authors: | Guo, D.Y. | Deposition date: | 2023-12-20 |
|
PDBID: | 8ris | Status: | HPUB -- hold until publication | Title: | Computationally redesigend variant of Pyrrolysyl-tRNA Synthetase (Y306A) | Authors: | Oberdorfer, G., Moser, M., Stoll, D. | Deposition date: | 2023-12-19 |
|
PDBID: | 8rip | Status: | HPUB -- hold until publication | Title: | Beta-keto acid cleavage enzyme from Paracoccus denitrificans with bound malonate and Coenzyme A | Authors: | Marchal, D.G., Zarzycki, J., Erb, T.J. | Deposition date: | 2023-12-19 |
|
PDBID: | 8xi3 | Status: | HOLD -- hold until a certain date | Title: | Structure of mouse SCMC-14-3-3gama complex | Authors: | Chi, P., Han, Z., Jiao, H., Li, J., Wang, X., Hu, H., Deng, D. | Deposition date: | 2023-12-19 | Release date: | 2024-12-19 |
|
PDBID: | 8xic | Status: | HOLD -- hold until a certain date | Title: | Structure of Trioxacarcin A covalently bound to guanosine-2''-fluorinated d(AACCGGTT)2 | Authors: | Gao, R.Q., Cao, C., Tang, G.L. | Deposition date: | 2023-12-19 | Release date: | 2024-12-19 |
|
PDBID: | 8xgx | Status: | HPUB -- hold until publication | Title: | beta-1,4-galacosyltransferase | Authors: | Luo, G., Huang, Z., Chen, J., Hou, X., Zhu, Y., Ni, D., Xu, W., Zhang, W., Rao, Y., Mu, W. | Deposition date: | 2023-12-15 |
|
PDBID: | 8rgm | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of nucleosome containing Widom603 DNA | Authors: | Motorin, N.A., Afonin, D., Armeev, G.A., Moiseenko, A., Zhao, L., Vasiliev, V., Oleinikov, P., Shaytan, A., Shi, X., Studitsky, V., Sokolova, O. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vco | Status: | HPUB -- hold until publication | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8xg3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of monomeric WDR11-FAM91A1 complex | Authors: | Jia, G.W., Deng, Q.H., Su, Z.M., Jia, D. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xeh | Status: | HPUB -- hold until publication | Title: | Crystal structure of HEPN-MNT complex | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | Deposition date: | 2023-12-12 |
|
PDBID: | 8xem | Status: | HPUB -- hold until publication | Title: | Crystal structure of apo HEPN toxin | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | Deposition date: | 2023-12-12 |
|
PDBID: | 8xeo | Status: | HPUB -- hold until publication | Title: | Crystal structure of MNT antitoxin | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | Deposition date: | 2023-12-12 |
|
PDBID: | 8reg | Status: | HPUB -- hold until publication | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (50 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2023-12-11 |
|
PDBID: | 8reh | Status: | HPUB -- hold until publication | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (125 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2023-12-11 |
|
PDBID: | 8rei | Status: | HPUB -- hold until publication | Title: | CTX-M-14 measured via serial crystallography from a silicon HARE-chip. | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2023-12-11 |
|
PDBID: | 8rej | Status: | HPUB -- hold until publication | Title: | Crystal structure of PPAR gamma Ligand Binding Domain in complex with the ligand LBB78 | Authors: | Capelli, D., Montanari, R. | Deposition date: | 2023-12-11 | Sequence: | >Entity 1 MGSSHHHHHHSSGLVPRGSHMAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
PDBID: | 8rem | Status: | HPUB -- hold until publication | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (50 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2023-12-11 |
|
PDBID: | 8vb3 | Status: | HPUB -- hold until publication | Title: | Dienelactone hydrolase from Solimonas fluminis | Authors: | Schnettler Fernandez, J.D.F., Campbell, E.C., Hollfelder, F. | Deposition date: | 2023-12-11 |
|
PDBID: | 8xe8 | Status: | HPUB -- hold until publication | Title: | Solution structure of ubiquitin-like domain (UBL) of human ZFAND1 | Authors: | Lai, C.H., Ko, K.T., Fan, P.J., Yu, T.A., Chang, C.F., Hsu, S.T.D. | Deposition date: | 2023-12-11 |
|
PDBID: | 8xdj | Status: | HPUB -- hold until publication | Title: | Crystal structure of AMPylated HEPN toxin | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | Deposition date: | 2023-12-11 |
|
PDBID: | 8xc7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of LL-D49194-alpha-1 covalently bound to guanosine-2''-fluorinated d(AACCGGTT)2 | Authors: | Gao, R.Q., Tang, G.L., Cao, C. | Deposition date: | 2023-12-08 | Release date: | 2024-12-08 |
|
PDBID: | 8xc8 | Status: | HPUB -- hold until publication | Title: | beta-1,4-galacosyltransferase | Authors: | Luo, G., Huang, Z., Chen, J., Hou, X., Zhu, Y., Ni, D., Xu, W., Zhang, W., Rao, Y., Mu, W. | Deposition date: | 2023-12-08 |
|