PDBID: | 9bf8 | Status: | HOLD -- hold until a certain date | Title: | SARS-CoV-2 Papain-like Protease (PLpro) Untagged Crystal Structure | Authors: | Al-Homoudi, A.I., Engel, J., Brunzelle, J.S., Gavande, N., Kovari, L.C. | Deposition date: | 2024-04-17 | Release date: | 2025-04-17 |
|
PDBID: | 9f0l | Status: | HPUB -- hold until publication | Title: | Scalable protein design using hallucination in a relaxed sequence space | Authors: | Frank, C.J., Motoyuki, H., Dietz, H. | Deposition date: | 2024-04-17 |
|
PDBID: | 9bf4 | Status: | AUTH -- processed, waiting for author review and approval | Title: | NMR solution structure of Paws Derived Peptide-25 (PDP-25) | Authors: | Hajiaghaalipour, F., Wong, W., Payne, C.D., Fisher, M.F., Clark, R.J., Mylne, J.S., Rosengren, K.J. | Deposition date: | 2024-04-16 |
|
PDBID: | 9bep | Status: | HPUB -- hold until publication | Title: | Structure of S1_8C, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-16 |
|
PDBID: | 9bes | Status: | HPUB -- hold until publication | Title: | Structure of S1_8A, a lambda-carrageenan specific sulfatase, in complex with monosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-16 |
|
PDBID: | 9beu | Status: | HPUB -- hold until publication | Title: | Structure of GH110B in complex with a lambda-carrageenan oligosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-16 |
|
PDBID: | 9bev | Status: | HPUB -- hold until publication | Title: | Structure of GH110A in complex with a lambda-carrageenan oligosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-16 |
|
PDBID: | 9bey | Status: | HPUB -- hold until publication | Title: | Structure of a lambda-carrageenan active GH2 A in complex with inhibitor | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-16 |
|
PDBID: | 9f0h | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of carboxysomal mini-shell icosahedral assembly from co-expression of CsoS1C, CsoS4A, and CsoS2-C (T = 9) | Authors: | Wang, P., Marles-Wright, J., Liu, L.N. | Deposition date: | 2024-04-16 |
|
PDBID: | 9f0k | Status: | HPUB -- hold until publication | Title: | Poliovirus type 1 (strain Mahoney) expanded conformation stabilised virus-like particle (PV1 SC6b) from a mammalian expression system | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | Deposition date: | 2024-04-16 |
|
PDBID: | 9bef | Status: | HPUB -- hold until publication | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 9beh | Status: | HPUB -- hold until publication | Title: | Structure of GH110A in complex with galactose-6-sulfate | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 8z2z | Status: | HPUB -- hold until publication | Title: | PRMT1-Tetramer | Authors: | Nadendla, E.K., Wang, C.H., Ho, M.C. | Deposition date: | 2024-04-14 |
|
PDBID: | 8z2q | Status: | HPUB -- hold until publication | Title: | Crystal structure of trehalose synthase mutant N253Q from Deinococcus radiodurans | Authors: | Ye, L.C., Chen, S.C. | Deposition date: | 2024-04-13 |
|
PDBID: | 8z2r | Status: | HPUB -- hold until publication | Title: | Crystal structure of trehalose synthase mutant N253T from Deinococcus radiodurans | Authors: | Ye, L.C., Chen, S.C. | Deposition date: | 2024-04-13 |
|
PDBID: | 8z2s | Status: | HPUB -- hold until publication | Title: | Crystal structure of trehalose synthase mutant R148A from Deinococcus radiodurans | Authors: | Ye, L.C., Chen, S.C. | Deposition date: | 2024-04-13 |
|
PDBID: | 8z2t | Status: | HPUB -- hold until publication | Title: | Crystal structure of trehalose synthase from Deinococcus radiodurans complexed with validoxylamine A (VAA) | Authors: | Ye, L.C., Chen, S.C. | Deposition date: | 2024-04-13 |
|
PDBID: | 8z2u | Status: | HPUB -- hold until publication | Title: | Crystal structure of trehalose synthase mutamt E324D from Deinococcus radiodurans complexed with validoxylamine A (VAA) | Authors: | Ye, L.C., Chen, S.C. | Deposition date: | 2024-04-13 |
|
PDBID: | 8z20 | Status: | HPUB -- hold until publication | Title: | Crystal structure analysis of thermotolerant Oscillatoria Phycocyanin | Authors: | Patel, S.N., Sonani, R.R., Gupta, G.D., Upadhyaya, C.T., Sonavane, B.P., Singh, N.K., Kumar, V., Madamwar, D. | Deposition date: | 2024-04-12 |
|
PDBID: | 8z2l | Status: | HPUB -- hold until publication | Title: | Crystal structure of trehalose synthase mutant N253E from Deinococcus radiodurans | Authors: | Ye, L.C., Chen, S.C. | Deposition date: | 2024-04-12 |
|
PDBID: | 9ezf | Status: | HOLD -- hold until a certain date | Title: | membrane complex from Haemophilus influenzae - conformation C | Authors: | Castro, D.S.K.V., Delepelaire, P., Biou, V. | Deposition date: | 2024-04-12 | Release date: | 2025-04-12 |
|
PDBID: | 8z1h | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of SARS main protease in complex with PF-00835231 | Authors: | Lin, C., Zhang, J., Li, J. | Deposition date: | 2024-04-11 | Release date: | 2025-04-11 |
|
PDBID: | 8z1g | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human ELAC2-pre-tRNA | Authors: | Liu, Z.M., Xue, C.Y. | Deposition date: | 2024-04-11 |
|
PDBID: | 8z1f | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human ELAC2-tRNA | Authors: | Liu, Z.M., Xue, C.Y. | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdb | Status: | HPUB -- hold until publication | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | Authors: | Schormann, N., Green, T., Turnbough, C.L. | Deposition date: | 2024-04-11 | Sequence: | >Entity 1 MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2 AFDPNLVGPTLPPIPPFTL
|
|