| PDBID: | 9dew | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of NDM-1 complexed with compound 2 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9dfb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Q108K:K40L:T51V:T53C:R58A:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V in the dark at pH 3.0 | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9df8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Q108K:K40L:T51V:T53C:R58A:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V and irradiated with UV light at pH 3.0 | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9jcm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Zea mays D-Phosphoglycerate dehydrogenase | | Authors: | Li, R., Wang, C. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9jci | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human pannexin 3 in nanodisc with C-terminal truncated | | Authors: | Zhang, H., Zhang, H.W., Wang, D. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9ddu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Q108K:K40L:T51V:T53C:R58Y:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V and irradiated with UV light at pH 3.0 | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de0 | | Status: | PROC -- to be processed | | Title: | The Cryo-EM structure of a complex between GAD65 and b96.11 Fab | | Authors: | Reboul, C.F., Le, S.N., Williams, D.E., Buckle, A.M. | | Deposition date: | 2024-08-28 | | Release date: | 2025-08-28 |
|
| PDBID: | 9de2 | | Status: | PROC -- to be processed | | Title: | ETO2 MYND bound to MPPL peptide from GATAD2A | | Authors: | Williams, D.C. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Q108K:K40L:T51V:T53C:R58Y:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V in the dark at pH 6.0 | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9ddl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Glutathione transferase sigma class from Taenia solium | | Authors: | Miranda-Blancas, R., Cardona-Echavarria, M.C., Sanchez, C., Sanchez-Perez, L.C., Flores-Lopez, R., Rodriguez-Lima, O., Garcia-Gutierrez, P., Zubillaga, R., Landa, A., Rudino-Pinera, E. | | Deposition date: | 2024-08-28 | | Release date: | 2025-08-28 |
|
| PDBID: | 9de7 | | Status: | PROC -- to be processed | | Title: | Structure of full-length HIV TAR RNA G16A/A17G | | Authors: | Bou-Nader, C., Zhang, J. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de5 | | Status: | PROC -- to be processed | | Title: | Structure of full-length HIV TAR RNA bound to HIV Tat RNA-binding domain | | Authors: | Bou-Nader, C., Zhang, J. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de8 | | Status: | PROC -- to be processed | | Title: | Structure of full-length HIV TAR RNA soaked in CaCl2 | | Authors: | Bou-Nader, C., Zhang, J. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of NDM-1 complexed with compound 28 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9jc3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of Ac-G51DA53T P1 a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9jc4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of Ac-G51DA53T P2 a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9jc5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of Ac-G51DA53T P3 a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9dcr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the TelA-associated type VII secretion system chaperone SIR_0168 | | Authors: | Gkragkopoulou, P., Kim, Y., Whitney, J.C. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glb | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Deacetylase (HdaH) from Klebsiella pneumoniae subsp. ozaenae | | Authors: | Qin, C., Graf, L.G., Schulze, S., Palm, G.J., Lammers, M. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glf | | Status: | HOLD -- hold until a certain date | | Title: | Anthraquinone Pigment Production Regulated by Cinnamic Acid | | Authors: | Su, L., Schmalhofer, M., Grammbitter, G.L.C., Paczia, N., Glatter, T., Groll, M., Bode, H.B. | | Deposition date: | 2024-08-27 | | Release date: | 2025-08-27 | | Sequence: | >Entity 1
GSSHHHHHHSGDPASMNNKNKPNRISPELLATCGYFMPRIFFLNSQYAPQVHWGDVVAALSHFPAGNLDLSSEEFWYEWMINWSKVGDSYINIANSAKSEVSHVRALRSAAACYHWAEFMYFSDRSRKIQLREYIRSCFLSSIKYSDLLVDHQYIVVDKFHMPFFLIFPKGYKEEENHPLPCVILSNGLDSMTEIEILSLAEFFLGKNMAVAIFDGPGQGINLGKSPIAIDMELYVSSIVKLLEDDARINSNLLCFLGISFGGYFALRVAQRIGDKFCCIVNLSGGPEIAEFDKLPRRLKEDFQFAFMQDNSHMQSIFDEIKLDISLPCKTKVFTVHGELDDIFQIDKVKKLDQLWGDNHQLLCYESEAHVCLNKINEYMIQVSDWVSEQFWLNGYKKG
|
|
| PDBID: | 9gl5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of the Thermus thermophilus Q190E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state | | Authors: | Neissner, K., Woehnert, J. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of the Thermus thermophilus Q218E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state | | Authors: | Neissner, K., Woehnert, J. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9gle | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Jumonji domain-containing protein 2A with crystallization epitope mutations A91T:T93S | | Authors: | Fairhead, M., Strain-Damerell, C., Ye, M., Mackinnon, S.R., Pinkas, D., MacLean, E.M., Koekemoer, L., Damerell, D., Krojer, T., Arrowsmith, C.H., Edwards, A., Bountra, C., Yue, W., Burgess-Brown, N., Marsden, B., von Delft, F., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human SOD1 (C6A/C111A) amyloid filament | | Authors: | Baek, Y., Kim, H., Lee, D., Kim, D., Jo, E., Roh, S.-H., Ha, N.-C. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human SOD1 (WT) amyloid filament | | Authors: | Baek, Y., Kim, H., Lee, D., Kim, D., Jo, E., Roh, S.-H., Ha, N.-C. | | Deposition date: | 2024-08-27 |
|
