| PDBID: | 9qw4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic PhosII-HepII-HepI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepI-(1,5)-KdoI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-12 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9ufc | | Status: | HOLD -- hold until a certain date | | Title: | Structural of a glutamate cysteine ligase StGSH1 in Solanum tuberosum | | Authors: | Zhao, H.B., Fan, S.L. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 |
|
| PDBID: | 9uap | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of ligand-free active-state M1 muscarinic acetylcholine receptor with alpha5 helix of G11 protein complex | | Authors: | Zhang, X., Gao, K., Liu, X. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9nys | | Status: | HPUB -- hold until publication | | Title: | Human DNA Ligase 1 E346A/E592A/K845N triple mutant with 3''-A:T nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9nww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Single-particle cryo-EM structure of the first variant of mobilized colistin resistance (MCR-1) in its ligand-bound state | | Authors: | Zinkle, A.P., Bunuro-Batista, M., Herrera, C.M., Erramilli, S.K., Kloss, B., Ashraf, K.U., Nosol, K., Zhang, G., Cater, R.J., Marty, M.T., Kossiakoff, A.A., Trent, M.S., Nygaard, R., Stansfeld, P.J., Mancia, F. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qk7 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 1 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qk8 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 2 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qk9 | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 3 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qka | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 4 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkb | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 5 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkc | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 6 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkd | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 7 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qke | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 8 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkf | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 9 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkh | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 11 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qki | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 12 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkj | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 13 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkk | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 14 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkl | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 15 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkm | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 16 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qkg | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 10 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9qfs | | Status: | HPUB -- hold until publication | | Title: | Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 8. | | Authors: | Breed, J. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 9qfy | | Status: | HPUB -- hold until publication | | Title: | Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 9. | | Authors: | Breed, J. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 9qf1 | | Status: | HPUB -- hold until publication | | Title: | Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 2 | | Authors: | Breed, J. | | Deposition date: | 2025-03-11 |
|
