PDBID: | 8zbn | Status: | HPUB -- hold until publication | Title: | Mouse MYH6 R404Q left ventricle ATM complex | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | Deposition date: | 2024-04-26 |
|
PDBID: | 9f49 | Status: | HOLD -- hold until a certain date | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | Authors: | Pichel, A., van Raaij, M.J. | Deposition date: | 2024-04-26 | Release date: | 2024-06-21 | Sequence: | >Entity 1 KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
PDBID: | 9f38 | Status: | HPUB -- hold until publication | Title: | BsmI (wild-type) crystallized with Ca2+ and cognate dsDNA | Authors: | Sieskind, R., Missoury, S., Madru, C., Commenge, I., Niogret, G., Hollenstein, M., Rondelez, Y., Haouz, A., Sauguet, L., Legrand, P., Delarue, M. | Deposition date: | 2024-04-25 |
|
PDBID: | 9bj3 | Status: | HPUB -- hold until publication | Title: | Structure of the SARS-CoV-2 S 6P trimer complex with the human neutralizing antibody Fab fragment, C1596 | Authors: | Rubio, A.A., Abernathy, M.E., Barnes, C.O. | Deposition date: | 2024-04-24 |
|
PDBID: | 9bj2 | Status: | HPUB -- hold until publication | Title: | Structure of the SARS-CoV-2 S 6P trimer complex with the human neutralizing antibody Fab fragment, C1533 (local refinement of NTD and C1533) | Authors: | Rubio, A.A., Abernathy, M.E., Barnes, C.O. | Deposition date: | 2024-04-24 |
|
PDBID: | 9bj4 | Status: | HPUB -- hold until publication | Title: | Structure of the SARS-CoV-2 S 6P trimer complex with the human neutralizing antibody Fab fragment, C952 | Authors: | Rubio, A.A., Abernathy, M.E., Barnes, C.O. | Deposition date: | 2024-04-24 |
|
PDBID: | 9bip | Status: | HPUB -- hold until publication | Title: | Human proton sensing receptor GPR4 in complex with miniGs | Authors: | Howard, M.K., Hoppe, N., Huang, X.P., Macdonald, C.B., Mehrotra, E., Rockefeller Grimes, P., Zahm, A.M., Trinidad, D.D., English, J., Coyote-Maestas, W., Manglik, A. | Deposition date: | 2024-04-24 |
|
PDBID: | 9bj1 | Status: | HPUB -- hold until publication | Title: | Crystal structure of inhibitor GNE-6893 bound to HPK1 | Authors: | Kiefer, J.R., Tellis, J.C., Chan, B.K., Wang, W., Wu, P., Choo, E.F., Heffron, T.P., Wei, B., Siu, M. | Deposition date: | 2024-04-24 |
|
PDBID: | 8z9i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of RaTG13 RBD bound to bat ACE2 | Authors: | Lan, J., Wang, C.H. | Deposition date: | 2024-04-23 |
|
PDBID: | 8z9v | Status: | HPUB -- hold until publication | Title: | Amyloid beta and TTR | Authors: | Lee, H.N., Han, C.W., Jang, S.B., Jeong, M.S. | Deposition date: | 2024-04-23 |
|
PDBID: | 8z9l | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of SARS-CoV-2 RBD bound to bat ACE2 | Authors: | Lan, J., Wang, C.H. | Deposition date: | 2024-04-23 |
|
PDBID: | 9bie | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | human ZYG11B ElonginB/C complex binding to SARS-CoV2 Orf10 protein | Authors: | Liu, X., Gross, J.D. | Deposition date: | 2024-04-23 |
|
PDBID: | 9bik | Status: | HPUB -- hold until publication | Title: | Crystal structure of inhibitor 1 bound to HPK1 | Authors: | Kiefer, J.T., Tellis, J.C., Chan, B.K., Wang, W., Wu, P., Siu, M., Heffron, T.P., Choo, E.F. | Deposition date: | 2024-04-23 |
|
PDBID: | 8z95 | Status: | HPUB -- hold until publication | Title: | Humanized anti-PEG h6.3 Fab in complex with PEG | Authors: | Lin, Y.C., Chang, C.Y., Su, Y.C. | Deposition date: | 2024-04-22 |
|
PDBID: | 8z93 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of amyloid fibril formed by human RIPK1 RHIM protein | Authors: | Ma, Y., Zhao, K., Liu, C. | Deposition date: | 2024-04-22 |
|
PDBID: | 8z94 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of RIPK1 RHIM PFFs cross seeded RIPK3 RHIM amyloid fibril | Authors: | Ma, Y., Zhao, K., Liu, C. | Deposition date: | 2024-04-22 |
|
PDBID: | 9bi6 | Status: | HPUB -- hold until publication | Title: | Human proton sensing receptor GPR68 in complex with miniGsq | Authors: | Howard, M.K., Hoppe, N., Huang, X.P., Macdonald, C.B., Mehrotra, E., Rockefeller Grimes, P., Zahm, A.M., Trinidad, D.D., English, J., Coyote-Maestas, W., Manglik, A. | Deposition date: | 2024-04-22 |
|
PDBID: | 9bi8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of inhibitor GNE-6893 bound to HPK1 | Authors: | Kiefer, J.R., Tellis, J.C., Chan, B.K., Wang, W., Wu, P., Choo, E.F., Heffron, T.P., Wei, B., Siu, M. | Deposition date: | 2024-04-22 |
|
PDBID: | 9f27 | Status: | HPUB -- hold until publication | Title: | Solution structure of the Pyrococcus abyssi Rpa2 winged-helix domain | Authors: | Le Meur, R.A., Madru, C., Cordier, F., Sauguet, L., Guijarro, J.I. | Deposition date: | 2024-04-22 |
|
PDBID: | 9f26 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the PriS_PriL-Rpa2WH ternary complex from P. abyssi | Authors: | Madru, C., Legrand, P., Haouz, A., Sauguet, L. | Deposition date: | 2024-04-22 |
|
PDBID: | 9f28 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the heterodimeric primase from pyrococcus abyssi (deletion of the PriL-CTD domain) | Authors: | Madru, C., Sauguet, L. | Deposition date: | 2024-04-22 |
|
PDBID: | 9bhl | Status: | HPUB -- hold until publication | Title: | Human proton sensing receptor GPR65 in complex with miniGs | Authors: | Howard, M.K., Hoppe, N., Huang, X.P., Macdonald, C.B., Mehrotra, E., Rockefeller Grimes, P., Zahm, A.M., Trinidad, D.D., English, J., Coyote-Maestas, W., Manglik, A. | Deposition date: | 2024-04-21 |
|
PDBID: | 9bhm | Status: | HPUB -- hold until publication | Title: | Human proton sensing receptor GPR68 in complex with miniGs | Authors: | Howard, M.K., Hoppe, N., Huang, X.P., Macdonald, C.B., Mehrotra, E., Rockefeller Grimes, P., Zahm, A.M., Trinidad, D.D., English, J., Coyote-Maestas, W., Manglik, A. | Deposition date: | 2024-04-21 |
|
PDBID: | 8z7o | Status: | HPUB -- hold until publication | Title: | PRMT1-Filament | Authors: | Nadendla, E.K., Wang, C.H. | Deposition date: | 2024-04-20 |
|
PDBID: | 8z7h | Status: | HPUB -- hold until publication | Title: | PRMT1-Decamer | Authors: | Nadendla, E.K., Wang, C.H. | Deposition date: | 2024-04-20 |
|