| PDBID: | 9lol | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human MON1A-CCZ1-RAB7A | | Authors: | Li, X., Li, D., Tang, D., Wang, J., Qi, S. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9mzg | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of GCGR-Gs complex with glucagon | | Authors: | Zhang, X., Belousoff, M.J., Wootten, D., Sexton, P.M., Jiang, Y. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9mze | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of GLP-1R-Gs complex with oxyntomodulin | | Authors: | Zhang, X., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9mzf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of GLP-1R-Gs complex with peptide 15 | | Authors: | Zhang, X., Belousoff, J.M., Wootten, D., Sexton, M.P. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the AGR2 and IRE1beta_loop complex | | Authors: | Yan, Y., Ron, D. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9lnf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SpoIVB_101-426-S378A | | Authors: | Jiang, L.G., Zhu, J., Huang, M.D. | | Deposition date: | 2025-01-21 |
|
| PDBID: | 9mxu | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of GLP-1R-Gs complex with glucagon | | Authors: | Zhang, X., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxo | | Status: | HPUB -- hold until publication | | Title: | Motif2-Motif1 Left-handed parallel G-quadruplex in H3 Spacegroup | | Authors: | Hendrickson, A.D., Xing, E.R., Yatsunyk, L.A. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9ln7 | | Status: | HPUB -- hold until publication | | Title: | Alpha-7 nicotinic acetylcholine receptor bound to inhibitory bicyclic peptide KP2007 in a resting state. | | Authors: | Chen, H., Sun, D., Tian, C. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human E104A calmodulin:MLCK RM20 complex | | Authors: | Brunzelle, J.S., Shuvalova, L., Watterson, D.M. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lmm | | Status: | HPUB -- hold until publication | | Title: | An antibiotic biosynthesis monooxygenase family protein from Streptomyces sp. MA37 | | Authors: | Jiang, K., Qu, X.D. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lm6 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 1D8 | | Authors: | Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S. | | Deposition date: | 2025-01-18 | | Release date: | 2026-01-18 |
|
| PDBID: | 9lm5 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 2A5 | | Authors: | Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S. | | Deposition date: | 2025-01-18 | | Release date: | 2026-01-18 |
|
| PDBID: | 9lm4 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 2A5 | | Authors: | Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S. | | Deposition date: | 2025-01-18 | | Release date: | 2026-01-18 |
|
| PDBID: | 9lm7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structrue of wuRFP-Pr1-88. | | Authors: | Guangming, D., Zehui, X., Longxing, C. | | Deposition date: | 2025-01-18 |
|
| PDBID: | 9lma | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ornithine decarboxylase H346A mutant without PLP | | Authors: | Kim, D.S., Park, J.H., Adiko, N.N., Seo, H.T. | | Deposition date: | 2025-01-18 |
|
| PDBID: | 9lm8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of wuRFP-Pfr21 | | Authors: | Guangming, D., Zehui, X., Longxing, C. | | Deposition date: | 2025-01-18 |
|
| PDBID: | 9lm9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of wuRFP-Pfr16-v34 | | Authors: | Guangming, D., Zehui, X., Longxing, C. | | Deposition date: | 2025-01-18 |
|
| PDBID: | 9mx6 | | Status: | HPUB -- hold until publication | | Title: | Apo EcHerA Pentamer Assembly | | Authors: | Rish, A.D., Fu, T., Fosuah, E. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9mx7 | | Status: | HPUB -- hold until publication | | Title: | Apo EcHerA Tetramer Assembly | | Authors: | Rish, A.D., Fu, T., Fosuah, E. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ornithine decarboxylase H216F mutant without PLP | | Authors: | Kim, D.S., Park, J.H., Adiko, N.N., Seo, H.T. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9ll3 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Enterobacter cloaca transaldolase in complex with D-fructose-6-phosphate. | | Authors: | Kamitori, S. | | Deposition date: | 2025-01-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHSMELYLDTSDVAAVKKLARIFPLAGVTTNPSIVAAGKTPLDELLPALHDALGGKGRLFAQVMATTAEGMVEDARKLRAIINDLVVKVPVTVEGLAAIKMLKAEGIPTLGTAVYGAAQGMLSALAGAEYVAPYVNRVDAQGGDGIQTVIELQQLLTLHAPQSKVLAASFKTPRQALDCLLAGCESITLPLDVAQQFITSPAVDAAIVKFEQDWQGAFGRTSI
|
|
| PDBID: | 9llm | | Status: | HPUB -- hold until publication | | Title: | Structure of C-Terminal of AB40 Peptide containing GXXXG Motif in SDS Micelles | | Authors: | Sarkar, D., Bhunia, A. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9lls | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ornithine decarboxylase H346A mutant | | Authors: | Kim, D.S., Park, J.H., Adiko, N.N., Seo, H.T. | | Deposition date: | 2025-01-17 |
|
| PDBID: | 9lkg | | Status: | HPUB -- hold until publication | | Title: | Ornithine decarboxylase from Lacticaseibacillus rhamnosus | | Authors: | Kim, D.S., Park, J.H., Adiko, N.N., Seo, H.T. | | Deposition date: | 2025-01-16 |
|
