| PDBID: | 9uj8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SME-1 E166A with cefovecin | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9uja | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SME-1 E166A with cefotetan | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9uk2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human OXGR1-miniGq complex (conformation 1) | | Authors: | Wang, C., Liu, H. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9uj5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SME-1 E166A in complex with cefprozil | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9uj6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SME-1 E166A in complex with cefsulodin | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9ujb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of SME-1 E166A in complex with Ceftobiprole | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9ujc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of SME-1 E166A with cefpirome | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9qxz | | Status: | HPUB -- hold until publication | | Title: | Structure of human NONO bound to (R)-SKBG-1 in p212121 | | Authors: | Fribourg, S., Fribourg, S. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qy4 | | Status: | HPUB -- hold until publication | | Title: | GT108 family enzyme from Chlamydia abortus in complex with mannose-1-phosphate (M1P) | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9uir | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the prostaglandin D2 receptor 1 (DP1) bound to the antagonist laropiprant resolved via the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9uis | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the prostaglandin D2 receptor 1 (DP1) bound to the antagonist asapiprant resolved via the fusion/crosslinking strategy | | Authors: | Han, S.C., Li, M.H. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9o84 | | Status: | HPUB -- hold until publication | | Title: | Structure of turkey hemoglobin A at 1.7 Angstrom resolution (tetragonal form) | | Authors: | Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9qwl | | Status: | HPUB -- hold until publication | | Title: | Hemolysin-coregulated-protein-1 (Hcp1) from Bacteroides fragilis strain NCTC9343 | | Authors: | Sauer, U.H., Cisneros, D.A. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
(MSE)AFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILEN(MSE)TNQFKPHSGSIVFKKGDEEAK(MSE)KELTWENGYITEFTENIDIVGSQP(MSE)TITFVVSAQVIKIGGAQFEQNWPKASGGGHHHHHH
|
|
| PDBID: | 9uhf | | Status: | HPUB -- hold until publication | | Title: | JN.1 RBD in complex with antibody BA5-12 | | Authors: | Yue, C., Mao, X. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9uhg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | JN.1 RBD in complex with antibody BA5-12-CDR1 | | Authors: | Yue, C., Mao, X. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9uh9 | | Status: | HPUB -- hold until publication | | Title: | human Ribonuclease MRP state 1 | | Authors: | Zhou, B., Lan, P., Wu, J., Lei, M. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9uho | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | JN.1 Spike in complex with antibody BA5-39 | | Authors: | Yue, C., Mao, X. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9uhq | | Status: | HPUB -- hold until publication | | Title: | Local refinement of JN.1 spike in complex with antibody BA5-39 | | Authors: | Yue, C., Mao, X. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qvy | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme complex with mannose-1-phosphate (M1P) | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepI-(1,5)-KdoI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-12 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qv4 | | Status: | HPUB -- hold until publication | | Title: | 1-Phosphofructokinase mutant K95T/G110S from E. coli with bound fructose-1,6-bisphosphate and ADP | | Authors: | Zarzycki, J., Dronsella, B., Erb, T.J., Lindner, S.N. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9uf6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of BA1-1-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9uey | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 1 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o4t | | Status: | HPUB -- hold until publication | | Title: | RT XFEL structure of Soybean Lipoxygenase-1 in large unit-cell | | Authors: | Wolff, A.M., Thompson, M.C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o2w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 complexed with compound 3 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2025-04-04 |
|
