| PDBID: | 9csf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a dimeric ubiquitin variant (UbV3) that inhibits the protease (PRO) from Turnip Yellow Mosaic Virus (TYMV) | | Authors: | Kim, K., Mark, B.L. | | Deposition date: | 2024-07-23 |
|
| PDBID: | 9csh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Turnip Yellow Mosaic Virus (TYMV) protease (PRO) bound to a ubiquitin variant (UbV3) | | Authors: | Kim, K., Mark, B.L. | | Deposition date: | 2024-07-23 |
|
| PDBID: | 9g8o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | human 40S ribosome bound by a SKI238-exosome complex | | Authors: | Koegel, A., Keidel, A., Loukeri, M.J., Kuhn, C.C., Langer, L.M., Schaefer, I.B., Conti, E. | | Deposition date: | 2024-07-23 |
|
| PDBID: | 9crd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SARS-CoV-2 Spike Proteins on intact virions: B.1 variant 1 open RBD | | Authors: | Ke, Z., Croll, T.I., Briggs, J.A.G. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9crw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Candida albicans kinesin-8 proximal tail domain | | Authors: | Trofimova, D., Doubleday, C., Hunter, B., Serrano Arevalo, J., Davison, E., Wen, E., Munro, K., Allingham, J.S. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9cre | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SARS-CoV-2 Spike Proteins on intact virions: Alpha (B.1.1.7) variant 3 closed RBDs | | Authors: | Ke, Z., Croll, T.I., Briggs, J.A.G. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9crf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SARS-CoV-2 Spike Proteins on intact virions: Alpha (B.1.1.7) variant 1 open RBD | | Authors: | Ke, Z., Croll, T.I., Briggs, J.A.G. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9crh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SARS-CoV-2 Spike Proteins on intact virions: Delta (B.1.617.2) variant 3 closed RBDs | | Authors: | Ke, Z., Briggs, J.A.G. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9cri | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SARS-CoV-2 Spike Proteins on intact virions: Mu (B.1.621) variant 3 closed RBDs | | Authors: | Ke, Z., Briggs, J.A.G. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9ius | | Status: | PROC -- to be processed | | Title: | Structure of a hierarchical intermediate region (axiafirbil) of human collagen type | | Authors: | Zhang, L.J., Fang, B.H. | | Deposition date: | 2024-07-22 | | Release date: | 2025-01-22 |
|
| PDBID: | 9crc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SARS-CoV-2 Spike Proteins on intact virions: B.1 variant 3 closed RBDs | | Authors: | Ke, Z., Croll, T.I., Briggs, J.A.G. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9g7i | | Status: | HPUB -- hold until publication | | Title: | Structure of carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) in complex with acetyl-Coenyzme A from Clostridium autoethanogenum | | Authors: | Lemaire, O.N., Dongsheng, Y.M., Murphy, B.J., Wagner, T. | | Deposition date: | 2024-07-21 | | Sequence: | >Entity 1
MNLFQTVFTGSKQALAAAEGIVKQAVDEKGRDYKVAFPDTAYSLPVIFAATGKKITNVGELEGALDIVRSLIVEEEMLDKLLNSGLATAVAAEIIEAAKYVLSDAPYAEPCVGFISDPIIRSLGVPLVTGDIPGVAVILGECPDSETAAKIIKDYQSKGLLTCLVGKVIDQAIEGKVKMGLDLRVIPLGYDVTSVIHVVTIAIRAALIFGGIKGGQLNDILKYTAERVPAFVNAFGPLSELVVSAGAGAIALGFPVLTDQVVPEVPTLLLTQKDYDKMVKTSLEARNIKIKITEIPIPVSFAAAFEGERIRKNDMLAEFGGNKTKAWELVMCADQGEVEDHKIEVIGPDIDTIDKAPGRMPLGMLIKVSGTNMQKDFEPVLERRLHYFLNYIEGVMHVGQRNLTWVRIGKEAFEKGFRLKHFGEVIYAKMLDEFGSVVDKCEVTIITDPGKAEELEGKYAVPRYKERDARLESLVDEKVDTFYSCNLCQSFAPAHVCIVTPERLGLCGAVSWLDAKATLELNPTGPCQAVPKEGVVDENLGIWEKVNETVSKISQGAVTSVTLYSILQDPMTSCGCFECITGIMPEANGVVMVNREFGATTPLGMTFGELASMTGGGVQTPGFMGHGRQFIASKKFMKGEGGLGRIVWMPKELKDFVAEKLNKTAKELYNIDNFADMICDETIATESEEVVKFLEEKGHPALKMDPIM
>Entity 2
MEEKAKSIDQATLQLLDKAKQDGVETVWDRKADMKVQCGFGSAGVCCRNCSMGPCRVSPVPGKGVERGICGATADVIVSRNFARMVAAGTAAHSDHGRSIALSLYHTSKDGDIKVKDENKLKEVAKSFNVETEGRDIYDIAHDVAKEGLSNYGKQLGEVTLPPSLPEKRKELWRKLGVYPRAVDREIAAVMHSTHIGCNADAEAMIKMSMRCSLTDGWMGSFMGTEFSDIMFGTPHSIDTEANLGVLEKNSVNVVLHGHEPLLSEMVVEAASDPELVELAKSVGADGINLCGMCCTGNEVSMRHGIKIAGNFMQQELAVVTGAVDGLIVDVQCIMPALAKLSKSYHTKFITTSPKAHITDSIYMEFDEENPLDSAKKILKEAILNFKNRDQSKVMIPELKCKAILGYSVEEIINKLDKVVNTQIGPMQTVKPLADVLVSGVLRGAAAVVGCNNPKVVQDSAHIETIKGLIKNDVIVVVTGCAAQAAAKYGLLQKEAAEKYAGPGLATVCKLVDIPPVLHMGSCVDISRILDLVGRVANLLGVDMSDLPVAGVAPEWMSEKAVAIGTYVVTSGIDTWLGVAPPVTGGPEVVDILTNKMEDWVGAKFFIETDPHKAVEQIVNRMNEKRKKLGI
|
|
| PDBID: | 9g71 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TTYH2 with lipids in GDN | | Authors: | Sukalskaia, A., Weber, F., Plochberger, B., Dutzler, R. | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g72 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of S. epidermidis ClpP in complex with tavaborole - soaking | | Authors: | Alves Franca, B., Rohde, H., Betzel, C. | | Deposition date: | 2024-07-19 | | Release date: | 2024-08-16 |
|
| PDBID: | 9g6x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TTYH2 in complex with sybody 1 in GDN | | Authors: | Sukalskaia, A., Weber, F., Plochberger, B., Dutzler, R. | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9it1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Pin1 using laue diffraction | | Authors: | Sun, B., Qi, Q., Xiao, Q.J., Wang, Z.J. | | Deposition date: | 2024-07-19 | | Release date: | 2024-08-16 |
|
| PDBID: | 9it0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ligand bound acetyltransferase | | Authors: | Park, J.B. | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g6i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of S. epidermidis ClpP in complex with bortezomib - cocrystallization | | Authors: | Alves Franca, B., Rohde, H., Betzel, C. | | Deposition date: | 2024-07-18 | | Release date: | 2024-08-15 |
|
| PDBID: | 9isq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Apo-state acetyltransferase | | Authors: | Park, J.B. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9isp | | Status: | HPUB -- hold until publication | | Title: | DUF2436 domain which is frequently found in virulence proteins from Porphyromonas gingivalis | | Authors: | Kim, B., Hwang, J., Do, H., Lee, J.H. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9g5j | | Status: | HPUB -- hold until publication | | Title: | Structure of the PRO-PRO endopeptidase (PPEP-3) E153A Y189F in complex with substrate peptide Ac-EPLPPPP-NH2 from Geobacillus thermodenitrificans | | Authors: | Claushuis, B., Wojtalla, F., van Leeuwen, H., Corver, J., Baumann, U., Hensbergen, P. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9is5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of Plant-Complex-C-5a | | Authors: | Wang, J.Z., Zhao, J., Xu, B., Li, X.H. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9is6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of Plant-Complex-C-5b | | Authors: | Wang, J.Z., Zhao, J., Li, X.H., Xu, B. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9isd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human secretory glutaminyl cyclase in complex with the inhibitor N-(1H-benzo[d]imidazol-5-yl)-1-phenylmethanesulfonamide | | Authors: | Li, G.-B., Yu, J.-L., Zhou, C., Ning, X.-L., Mou, J., Wu, J.-W., Meng, F.-B. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9irp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of ClpP from Staphylococcus aureus in complex with ZG297 | | Authors: | Wei, B.Y., Wang, P.Y., Zhang, T., Yang, C.-G. | | Deposition date: | 2024-07-16 | | Release date: | 2025-07-16 |
|
