Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9v8n
Status:HPUB -- hold until publication
Title:Crystal structure of human glutaminyl-peptide cyclotransferase with I321V mutation, in complex with (E)-3-(2-methoxyphenyl)-6-((5-(prop-1-en-1-yl)-1H-imidazol-1-yl)methyl)pyridin-2(1H)-one
Authors:Li, G.B., Ning, X.-L.
Deposition date:2025-05-29
PDBID:9v8m
Status:HPUB -- hold until publication
Title:Crystal structure of human glutaminyl-peptide cyclotransferase in complex with 3-phenyl-6-((5-propyl-1H-imidazol-1-yl)methyl)pyridin-2(1H)-one
Authors:Li, G.B., Ning, X.-L.
Deposition date:2025-05-29
PDBID:9ouc
Status:HPUB -- hold until publication
Title:Influenza A Virus Nucleoprotein(8-498)NP complex with 5-(4-(morpholinomethyl)phenyl)-2-oxo-6-(trifluoromethyl)-1,2-dihydropyridine-3-carboxamide (Compound 3)
Authors:Mamo, M.
Deposition date:2025-05-28
PDBID:9oug
Status:HPUB -- hold until publication
Title:Influenza A Virus Nucleoprotein(8-498)NP complex with rac-5-(4-(((2R,6R)-6-(methoxymethyl)-6-methyl-1,4-dioxan-2-yl)methoxy)phenyl)-2-oxo-6-(trifluoromethyl)-1,2-dihydropyridine-3-carboxamide (Compound 20)
Authors:Mamo, M.
Deposition date:2025-05-28
PDBID:9v6b
Status:HPUB -- hold until publication
Title:Neutron crystal structure of the oxidized form of b5R at pD 6.5
Authors:Hirano, Y., Kurihara, K., Kusaka, K., Ostermann, A., Hikita, M., Kimura, S., Miki, K., Tamada, T.
Deposition date:2025-05-27
PDBID:9v6c
Status:HPUB -- hold until publication
Title:Neutron crystal structure of the oxidized form of b5R at pD 7.5
Authors:Hirano, Y., Kurihara, K., Kusaka, K., Ostermann, A., Hikita, M., Kimura, S., Miki, K., Tamada, T.
Deposition date:2025-05-27
PDBID:9otu
Status:HPUB -- hold until publication
Title:Crystal Structure of Salmonella FraB Deglycase, E214A Mutant, Crystal Form 5
Authors:Bell, C.E., Zakharova, K.
Deposition date:2025-05-27
Sequence:

>Entity 1


MDHHHHHHENLYFQMEPEESMMGMKETVSNIVTSQAEKGGVKHVYYVACGGSYAAFYPAKAFLEKEAKALTVGLYNSGEFINNPPVALGENAVVVVASHKGNTPETIKAAEIARQHGAPVIGLTWIMDSPLVAHCDYVETYTFGDGKDIAGEKTMKGLLSAVELLQQTEGYAHYDDFQDGVSKINRIVWRACEQVAERAQAFAQEYKDDKVIYTVASGAGYGAAYLQSICIFMAMQWIHSACIHSGEFFHGPFEITDANTPFFFQFSEGNTRAVDERALNFLKKYGRRIEVVDAAALGLSTIKTTVIDYFNHSLFNNVYPVYNRALAEARQHPLTTRRYMWKVEY
PDBID:9v3s
Status:HPUB -- hold until publication
Title:Nav1.5 in complex with quinidine-azo
Authors:Huang, Z., Li, Z., Liu, S.
Deposition date:2025-05-22
PDBID:9v3d
Status:HPUB -- hold until publication
Title:SFX structure of 3-5 micrometers Lysozyme microcrystals
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3h
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 2 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3i
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 5 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3j
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 9.7 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3l
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 5.0 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3m
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 7.5 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3p
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 452 mM N-Acetyl-D-glucosamine at 2.5 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3r
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 452 mM N-Acetyl-D-glucosamine at 5.0 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9r9q
Status:AUTH -- processed, waiting for author review and approval
Title:[FeFe]-hydrogenase from Nitratidesulfovibrio vulgaris str. Hildenborough at pH 5.04
Authors:Bikbaev, K., Span, I.
Deposition date:2025-05-20
Release date:2026-05-20
PDBID:9r9r
Status:AUTH -- processed, waiting for author review and approval
Title:[FeFe]-hydrogenase from Nitratidesulfovibrio vulgaris str. Hildenborough at pH 5.21
Authors:Bikbaev, K., Span, I.
Deposition date:2025-05-20
Release date:2026-05-20
PDBID:9r9s
Status:HOLD -- hold until a certain date
Title:[FeFe]-hydrogenase from Nitratidesulfovibrio vulgaris str. Hildenborough at pH 5.45
Authors:Bikbaev, K., Span, I.
Deposition date:2025-05-20
Release date:2026-05-20
PDBID:9v1q
Status:HPUB -- hold until publication
Title:CTP synthase RXN-state 5
Authors:Guo, C.J.
Deposition date:2025-05-19
PDBID:9v2f
Status:WAIT -- processing started, waiting for author input to continue processing
Title:CTP synthase dDON-state 5
Authors:Guo, C.J.
Deposition date:2025-05-19
PDBID:9onu
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol-(1,2,4,5,6)-pentakisphosphate
Authors:Cleland, C.P., Mosimann, S.C.
Deposition date:2025-05-15
Release date:2025-11-15
PDBID:9ooi
Status:HPUB -- hold until publication
Title:Crystal structure of dihydrofolate reductase (DHFR) from the filarial nematode W. bancrofti in complex with NADPH and antifolate 2-({4-[(2-amino-4-oxo-4,7-dihydro-1H-pyrrolo[2,3-d]pyrimidin-5-yl)methyl]benzene-1-carbonyl}amino)benzoic acid (OG7 or TSD001)
Authors:Frey, K.M., Goodey, N.M., Kwarteng, S.
Deposition date:2025-05-15
PDBID:9r7w
Status:HPUB -- hold until publication
Title:5-Helix Tile - Twist Corrected (5HT-TC) with 2''-Fluoro-modified pyrimidines (FY RNA)
Authors:Kristoffersen, E.L., Andersen, E.S., Zwergius, N.H.
Deposition date:2025-05-15
PDBID:9r79
Status:HPUB -- hold until publication
Title:Imine Reductase IR91 from Kribbella flavida with NADP+ and 5-methoxy-2-tetralone
Authors:Srinivas, K., Gilio, A.K., Grogan, G.
Deposition date:2025-05-14

238582

PDB entries from 2025-07-09

PDB statisticsPDBj update infoContact PDBjnumon