PDBID: | 8zlp | Status: | HPUB -- hold until publication | Title: | apo WT polymorph 5a alpha-synuclein fibril | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2024-05-20 |
|
PDBID: | 8zlo | Status: | HPUB -- hold until publication | Title: | F0502B-bound E46K alpha-synuclein fibril | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2024-05-20 |
|
PDBID: | 8zli | Status: | HPUB -- hold until publication | Title: | BTA-2-bound E46K alpha-synuclein fibrils | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2024-05-20 |
|
PDBID: | 8zlk | Status: | HPUB -- hold until publication | Title: | PWWP domain from human DNMT3B | Authors: | Cho, C.-C., Yuan, H.S. | Deposition date: | 2024-05-20 |
|
PDBID: | 9bvx | Status: | HOLD -- hold until a certain date | Title: | SARS-CoV-2 main protease bound to inhibitor YR-C-155 | Authors: | Liu, W.R., Blankenship, L.R. | Deposition date: | 2024-05-20 | Release date: | 2025-05-20 |
|
PDBID: | 9bw3 | Status: | HPUB -- hold until publication | Title: | Consensus model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | Deposition date: | 2024-05-20 |
|
PDBID: | 9fdp | Status: | HPUB -- hold until publication | Title: | Single particle cryo-EM structure of the AcrB V612W monomer in the O state | Authors: | Lazarova, M., Boernsen, C., Frangakis, A., Pos, K.M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdh | Status: | HPUB -- hold until publication | Title: | Closed Human phosphoglycerate kinase complex with BPG and ADP produced by cross-soaking a TSA crystal | Authors: | Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdn | Status: | HPUB -- hold until publication | Title: | Human phosphoglycerate kinase in complex with ATP and 3PG formed by cross-soaking a TSA crystal | Authors: | Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fcz | Status: | HPUB -- hold until publication | Title: | Coxsackievirus A9 bound with compound 17 (CL301) | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | Deposition date: | 2024-05-16 |
|
PDBID: | 8zkj | Status: | HPUB -- hold until publication | Title: | The crystal structure of apo-LDHC | Authors: | Wu, C.Y., Wang, H.L. | Deposition date: | 2024-05-16 |
|
PDBID: | 9bu7 | Status: | HPUB -- hold until publication | Title: | Cryo-EM Structure of AAV2 Rep68 bound to integration site AAVS1: Insights into the mechanism of DNA melting. | Authors: | Escalante, C.R. | Deposition date: | 2024-05-16 | Sequence: | >Entity 1 GPPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDESYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG
>Entity 2 (DG)(DT)(DT)(DG)(DG)(DG)(DG)(DC)(DT)(DC)(DG)(DG)(DC)(DG)(DC)(DT)(DC)(DG)(DC)(DT)(DC)
>Entity 3 (DG)(DA)(DG)(DC)(DG)(DA)(DG)(DC)(DG)(DC)(DC)(DG)(DA)(DG)(DC)(DC)(DC)(DC)(DA)(DA)(DC)
|
|
PDBID: | 9bu9 | Status: | HPUB -- hold until publication | Title: | Mixed-valent (2/3) dimanganese SfbO | Authors: | Liu, C., Rittle, J. | Deposition date: | 2024-05-16 |
|
PDBID: | 9bua | Status: | HPUB -- hold until publication | Title: | SfbO reconstituted with Mn(II) anaerobically | Authors: | Liu, C., Rittle, J. | Deposition date: | 2024-05-16 |
|
PDBID: | 9fc6 | Status: | HPUB -- hold until publication | Title: | HEN EGG-WHITE Lysozyme incubated at 87% relative humidity | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc7 | Status: | HPUB -- hold until publication | Title: | HEN EGG-WHITE Lysozyme incubated at 99% relative humidity | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc8 | Status: | HPUB -- hold until publication | Title: | HEN EGG-WHITE Lysozyme incubated at 60% relative humidity | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | Deposition date: | 2024-05-15 |
|
PDBID: | 9btk | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-C-108T | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|
PDBID: | 9btr | Status: | HOLD -- hold until a certain date | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-C-163 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|
PDBID: | 9fbk | Status: | HPUB -- hold until publication | Title: | Diheme cytochrome c Kustd1711 from Kuenenia stuttgartiensis, without glycerol cryoprotectant | Authors: | Hauser, D., Barends, T.R.M. | Deposition date: | 2024-05-14 |
|
PDBID: | 9fbt | Status: | HPUB -- hold until publication | Title: | Structure of KPC-2 complexed with benzoxaborole AK-431 | Authors: | Beer, M., Tooke, C.L., Hinchliffe, P., Spencer, J. | Deposition date: | 2024-05-14 |
|
PDBID: | 8zip | Status: | HPUB -- hold until publication | Title: | Mouse left ventricle actin and myosin complex | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | Deposition date: | 2024-05-14 |
|
PDBID: | 8ziu | Status: | HPUB -- hold until publication | Title: | Mouse MYH6 R404Q left ventricle actin and myosin complex | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | Deposition date: | 2024-05-14 |
|
PDBID: | 8zj1 | Status: | HPUB -- hold until publication | Title: | Human left ventricle F-actin | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | Deposition date: | 2024-05-14 |
|
PDBID: | 8zix | Status: | HPUB -- hold until publication | Title: | RAT skeletal muscle F-actin | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | Deposition date: | 2024-05-14 |
|