PDBID: | 8rsd | Status: | AUTH -- processed, waiting for author review and approval | Title: | Thaumatin measured via serial crystallography from a kapton HARE-chip (125 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rse | Status: | HPUB -- hold until publication | Title: | Proteinase K measured via serial crystallography from a silicon HARE-chip | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rsf | Status: | HPUB -- hold until publication | Title: | Proteinase K measured via serial crystallography from a kapton HARE-chip (50 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rs7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Zika Virus NS2B-NS3 protease in complex with an allosteric inhibitor | Authors: | Ontario, J.M., Torrente, E. | Deposition date: | 2024-01-24 |
|
PDBID: | 8vpv | Status: | AUTH -- processed, waiting for author review and approval | Title: | Class III PreQ1 riboswitch mutant delta84 | Authors: | Srivastava, Y., Jenkins, J.L., Wedekind, J.E. | Deposition date: | 2024-01-17 |
|
PDBID: | 8voy | Status: | HPUB -- hold until publication | Title: | Cryo-EM map of influenza B virus neuraminidase in complex with human FluB-2 Fab | Authors: | Binshten, E., Crowe, J.E. | Deposition date: | 2024-01-16 |
|
PDBID: | 8vp0 | Status: | HPUB -- hold until publication | Title: | Cryo-EM map of influenza B virus neuraminidase in complex with human FluB-26 Fab | Authors: | Binshten, E., Crowe, J.E. | Deposition date: | 2024-01-16 |
|
PDBID: | 8vp2 | Status: | HPUB -- hold until publication | Title: | Cryo-EM map of influenza B virus neuraminidase in complex with human FluB-87 Fab | Authors: | Binshten, E., Crowe, J.E. | Deposition date: | 2024-01-16 |
|
PDBID: | 8vor | Status: | HPUB -- hold until publication | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 51 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | Deposition date: | 2024-01-15 |
|
PDBID: | 8voq | Status: | HPUB -- hold until publication | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 39 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | Deposition date: | 2024-01-15 |
|
PDBID: | 8vod | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of mouse Vps29 bound to DENND4C peptide | Authors: | Chen, K.-E., Collins, B. | Deposition date: | 2024-01-15 | Release date: | 2025-01-15 |
|
PDBID: | 8voo | Status: | HPUB -- hold until publication | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 39 nt long spacer, ops signal, RfaH, NusA, and fMet-tRNAs in E-site and P-site | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | Deposition date: | 2024-01-15 |
|
PDBID: | 8vop | Status: | HPUB -- hold until publication | Title: | Escherichia coli transcription-translation coupled complex (TTC-B) containing mRNA with a 36 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | Deposition date: | 2024-01-15 |
|
PDBID: | 8rov | Status: | HPUB -- hold until publication | Title: | Human dectin-2 with dimerization domain | Authors: | Liu, Y., Kim, J.W., Feinberg, H., Cull, N., Weis, W.I., Taylor, M.E., Drickamer, K. | Deposition date: | 2024-01-12 |
|
PDBID: | 8vlz | Status: | HOLD -- hold until a certain date | Title: | CryoEM structure of human S-OPA1 assembled on lipid membrane containing brominated cardiolipin in membrane-adjacent state | Authors: | Zuccaro, K.E., Aydin, H. | Deposition date: | 2024-01-12 | Release date: | 2025-01-12 |
|
PDBID: | 8vm4 | Status: | HOLD -- hold until a certain date | Title: | CryoEM structure of human S-OPA1 assembled on lipid membrane containing brominated cardiolipin in membrane-adjacent state | Authors: | Zuccaro, K.E., Aydin, H. | Deposition date: | 2024-01-12 | Release date: | 2025-01-12 |
|
PDBID: | 8vl1 | Status: | HPUB -- hold until publication | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 36 nt long spacer, ops signal, RfaH, NusA, and fMet-tRNAs in E-site and P-site | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | Deposition date: | 2024-01-11 |
|
PDBID: | 8rmy | Status: | HPUB -- hold until publication | Title: | Transglutaminase 3 in complex with inhibitor Z-don and DH patient-derived Fab DH63-A02 | Authors: | Heggelund, J.E., Sollid, L.M. | Deposition date: | 2024-01-09 |
|
PDBID: | 8rn6 | Status: | HPUB -- hold until publication | Title: | Pseudo-symmetrical influenza B polymerase apo-dimer, ENDO(E) moiety (from ""Influenza B polymerase pseudo-symmetrical dimer"" | Local refinement) | Authors: | Arragain, B., Cusack, S. | Deposition date: | 2024-01-09 |
|
PDBID: | 8rn8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Influenza B polymerase pseudo-symmetrical apo-dimer (FluPol(E)|FluPol(S)) | Authors: | Arragain, B., Cusack, S. | Deposition date: | 2024-01-09 |
|
PDBID: | 8vja | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of tail of bacteriophage Chi | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | Deposition date: | 2024-01-06 | Release date: | 2025-01-06 |
|
PDBID: | 8vjh | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of tail-tip of bacteriophage Chi | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | Deposition date: | 2024-01-06 | Release date: | 2025-01-06 |
|
PDBID: | 8vji | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of capsid of bacteriophage Chi | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | Deposition date: | 2024-01-06 | Release date: | 2025-01-06 |
|
PDBID: | 8rly | Status: | HPUB -- hold until publication | Title: | E. coli endonuclease IV complexed with sulfate, catalytic Fe2+ | Authors: | Saper, M.A., Paterson, N.G., Kirillov, S., Rouvinski, A. | Deposition date: | 2024-01-04 | Sequence: | >Entity 1 MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQTEKAVA
|
|
PDBID: | 8vi9 | Status: | HPUB -- hold until publication | Title: | NEMO IKK-binding domain with bound small molecule fragment | Authors: | Kennedy, A.E. | Deposition date: | 2024-01-03 | Sequence: | >Entity 1 GSWSVKELEDKNEELLSEIAHLKNEVARLKKLLQRCLAANQELRDAMRQSNQILRERAEELLHFQASQREEKEFLMSKFQEARKLVERLGLEKLELEDKNEELLSEIAHLKNEVARLKKLVGER
|
|