| PDBID: | 9g5m | | Status: | HPUB -- hold until publication | | Title: | N-Acyl-D-amino-acid deacylase (D-acylase) from Klebsiella pneumoniae in an open conformation | | Authors: | Gavira, J.A., Martinez-Rodriguez, S. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9g5n | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 20C using serial fixed-target crystallography | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9g5s | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 30C using serial fixed-target crystallography | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9g5w | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 40C using serial fixed-target crystallography | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9g5x | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 45C using serial fixed-target crystallography | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9g61 | | Status: | HPUB -- hold until publication | | Title: | Xylose Isomerase collected at 50C using serial fixed-target crystallography | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9g4t | | Status: | HPUB -- hold until publication | | Title: | Beta carbonic anhydrase CsoSCA from the Halothiobacillus neapolitanus alpha-carboxysome | | Authors: | Ng, P.C., Marles-Wright, J., Basle, A., Liu, L. | | Deposition date: | 2024-07-16 |
|
| PDBID: | 9g51 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LmrR with V15 replaced by unnatural amino acid 4-mercaptophenylalanine, apo | | Authors: | Thunnissen, A.M.W.H., Aalbers, F.S., Veen, M.J., Rozeboom, H.J., Roelfes, G. | | Deposition date: | 2024-07-16 |
|
| PDBID: | 9g52 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LmrR with V15 replaced by unnatural amino acid 4-mercaptophenylalanine, Au(I) bound | | Authors: | Thunnissen, A.M.W.H., Aalbers, F.S., Veen, M.J., Rozeboom, H.J., Roelfes, G. | | Deposition date: | 2024-07-16 |
|
| PDBID: | 9g4z | | Status: | HOLD -- hold until a certain date | | Title: | TRPC5 in complex with photoswitch E-AzHC | | Authors: | Porav, S.A., Bon, R., Muench, S. | | Deposition date: | 2024-07-16 | | Release date: | 2025-07-16 |
|
| PDBID: | 9g50 | | Status: | HOLD -- hold until a certain date | | Title: | TRPC5 in complex with photoswitch Z-AzHC | | Authors: | Porav, S.A., Bon, R., Muench, S. | | Deposition date: | 2024-07-16 | | Release date: | 2025-07-16 |
|
| PDBID: | 9g4y | | Status: | HOLD -- hold until a certain date | | Title: | TRPC5 in complex with photoswitch E-AzHC | | Authors: | Porav, S.A., Bon, R., Muench, S. | | Deposition date: | 2024-07-16 | | Release date: | 2025-07-16 |
|
| PDBID: | 9g5g | | Status: | HPUB -- hold until publication | | Title: | Glycoside Hydrolase Family 157 from Labilibaculum antarcticum (LaGH157) in complex with Laminaribiose | | Authors: | Caseiro, C., Alves, V.D., Carvalho, A.L., Bule, P. | | Deposition date: | 2024-07-16 |
|
| PDBID: | 9irv | | Status: | HPUB -- hold until publication | | Title: | MultiBody Refinement of dimeric DARPin and its bound GFP on a symmetric scaffold | | Authors: | Lu, X., Yan, M., Zhang, H.M., Hao, Q. | | Deposition date: | 2024-07-16 |
|
| PDBID: | 9irj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of PSmOrange3 (trigonal form) | | Authors: | Samygina, V.R., Subach, O.M., Vlaskina, A.V., Nikolaeva, A.Y., Subach, F.V. | | Deposition date: | 2024-07-16 |
|
| PDBID: | 9is4 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a TEF30-associated intermediate C2S-type PSII-LHCII supercomplex from Chlamydomonas reinhardtii | | Authors: | Wang, Y., Wang, C., Li, A., Liu, Z. | | Deposition date: | 2024-07-16 |
|
| PDBID: | 9g4n | | Status: | HPUB -- hold until publication | | Title: | Glycoside Hydrolase Family 157 from Labilibaculum antarcticum (LaGH157) E224A mutant in complex with Laminaritriose and Glucose | | Authors: | Caseiro, C., Alves, V.D., Carvalho, A.L., Bule, P. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9g4b | | Status: | HPUB -- hold until publication | | Title: | Human KRas4A (GDP) in complex with compound 15 | | Authors: | Schuettelkopf, A.W. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9g4a | | Status: | HPUB -- hold until publication | | Title: | Structure of human SETD2 T1663M mutant in complex with SAM and H3K36M peptide | | Authors: | Mechaly, A.E., Michail, C., Haouz, A., Rodrigues-Lima, F. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9g4m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of monoacylglycerol lipase with BODIPY labeled probe | | Authors: | Guberman, M., Hentsch, A., Radetzki, S., Kaushik, S., Huizenga, M., van der Stelt, M., Paul, J., Schippers, M., Hochstrasser, R., von Kries, J.P., Blaising, J., Lipstein, N., Nazare, M., Grether, U., Kuhn, B., Walter, A., Benz, J. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9ire | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF Bacillus cereus FERRIC UPTAKE REGULATOR | | Authors: | Gabdulkhakov, A.G., Tishchenko, T.V., Kostareva, O.S. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9cnf | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of heparanase P6 in complex with a small molecule | | Authors: | Davies, L.J., Whitefield, C., Frkic, R., Jackson, C.J. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9cmt | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of HP1alpha CSD-Agno complex | | Authors: | Goldgur, Y., Xie, W., Schaefer, U., Tarakhovsky, A., Patel, D., Chen, S. | | Deposition date: | 2024-07-15 |
|
| PDBID: | 9cmj | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of SARS-CoV-2 main protease drug resistant mutant (L50F, E166V) | | Authors: | Kovalevsky, A., Coates, L., Gerlits, O. | | Deposition date: | 2024-07-15 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMFNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMVLPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9cmn | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of SARS-CoV-2 main protease drug resistant mutant (E166A, L167F) | | Authors: | Kovalevsky, A., Coates, L., Gerlits, O. | | Deposition date: | 2024-07-15 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMAFPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
