Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:7i9g
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 28 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i9h
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 26 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i9i
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of 2 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:9u6e
Status:HPUB -- hold until publication
Title:FADD-DED filaments coordinate complex IIa assembly during TNF-induced apoptosis
Authors:Liu, P., Luo, D.
Deposition date:2025-03-23
PDBID:9nvz
Status:HPUB -- hold until publication
Title:Cryo-EM structure of rhesus antibody CH70-Apex1.01 in complex with HIV Env trimer Q23-APEX-GT2
Authors:Roark, R.S., Shapiro, L.S., Kwong, P.D.
Deposition date:2025-03-21
PDBID:9nw0
Status:HPUB -- hold until publication
Title:Cryo-EM structure of rhesus antibody CH42-Apex1.01 in complex with HIV Env trimer Q23-APEX-GT2
Authors:Roark, R.S., Shapiro, L.S., Kwong, P.D.
Deposition date:2025-03-21
PDBID:9nw1
Status:HPUB -- hold until publication
Title:Cryo-EM structure of rhesus antibody CH42-Apex2.01 in complex with HIV Env trimer Q23-APEX-GT2
Authors:Roark, R.S., Shapiro, L.S., Kwong, P.D.
Deposition date:2025-03-21
PDBID:9nvw
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of rhesus antibody CH35-Apex1.08 in complex with HIV Env trimer Q23-APEX-GT2
Authors:Roark, R.S., Shapiro, L.S., Kwong, P.D.
Deposition date:2025-03-21
PDBID:9qm6
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of highly stable methionine gamma-lyase from Thermobrachium celere in complex with PLP and norleucine
Authors:Kopecny, D., Ferchaud, N., Briozzo, P.
Deposition date:2025-03-21
PDBID:9qlr
Status:HPUB -- hold until publication
Title:Nonamer crystal structure of the transcription factor MraZ from Mycoplasma genitalium
Authors:Reverter, D., Sanchez-Alba, L.
Deposition date:2025-03-21
PDBID:9qky
Status:HPUB -- hold until publication
Title:The structure of the DNA-binding domain of Nuclear Factor 1 X bound to NFI consensus DNA sequence
Authors:Tiberi, M., Nardini, M., Chaves-Sanjuan, A., Gourlay, L.J., Bonnet, D.M.V.
Deposition date:2025-03-20
PDBID:9qld
Status:HPUB -- hold until publication
Title:Rhombohedral crystalline form of human insulin complexed with m-nitrophenol
Authors:Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D.
Deposition date:2025-03-20
Sequence:

>Entity 1


GIVEQCCTSICSLYQLENYCN

>Entity 2


FVNQHLCGSHLVEALYLVCGERGFFYTPKT
PDBID:9u4e
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the human CRP-CPS23F complex
Authors:Chen, D.Y., Xie, Y.F., Gao, F., Qi, J.X., Zhang, J.R.
Deposition date:2025-03-19
PDBID:9nug
Status:PROC -- to be processed
Title:D-Ornithine/D-lysine decarboxylase C387A complexed with putrescine, D-arginine and agmatine
Authors:Phillips, R.S., Blankenship, S.
Deposition date:2025-03-19
PDBID:9nu6
Status:HPUB -- hold until publication
Title:SARS-CoV-2 main protease with inhibitor
Authors:Dougan, D.R.
Deposition date:2025-03-19
PDBID:9qkl
Status:HPUB -- hold until publication
Title:NCS-1 bound to XChem ligand 15
Authors:Munoz-Reyes, D., Sanchez-Barrena, M.J.
Deposition date:2025-03-19
PDBID:9qk7
Status:HPUB -- hold until publication
Title:NCS-1 bound to XChem ligand 1
Authors:Munoz-Reyes, D., Sanchez-Barrena, M.J.
Deposition date:2025-03-19
PDBID:9qk8
Status:HPUB -- hold until publication
Title:NCS-1 bound to XChem ligand 2
Authors:Munoz-Reyes, D., Sanchez-Barrena, M.J.
Deposition date:2025-03-19
PDBID:9qk9
Status:HPUB -- hold until publication
Title:NCS-1 bound to XChem ligand 3
Authors:Munoz-Reyes, D., Sanchez-Barrena, M.J.
Deposition date:2025-03-19
PDBID:9qka
Status:HPUB -- hold until publication
Title:NCS-1 bound to XChem ligand 4
Authors:Munoz-Reyes, D., Sanchez-Barrena, M.J.
Deposition date:2025-03-19
PDBID:9qkb
Status:HPUB -- hold until publication
Title:NCS-1 bound to XChem ligand 5
Authors:Munoz-Reyes, D., Sanchez-Barrena, M.J.
Deposition date:2025-03-19
PDBID:9qkc
Status:HPUB -- hold until publication
Title:NCS-1 bound to XChem ligand 6
Authors:Munoz-Reyes, D., Sanchez-Barrena, M.J.
Deposition date:2025-03-19
PDBID:9qkd
Status:HPUB -- hold until publication
Title:NCS-1 bound to XChem ligand 7
Authors:Munoz-Reyes, D., Sanchez-Barrena, M.J.
Deposition date:2025-03-19
PDBID:9qke
Status:HPUB -- hold until publication
Title:NCS-1 bound to XChem ligand 8
Authors:Munoz-Reyes, D., Sanchez-Barrena, M.J.
Deposition date:2025-03-19
PDBID:9qkf
Status:HPUB -- hold until publication
Title:NCS-1 bound to XChem ligand 9
Authors:Munoz-Reyes, D., Sanchez-Barrena, M.J.
Deposition date:2025-03-19

238582

PDB entries from 2025-07-09

PDB statisticsPDBj update infoContact PDBjnumon