| PDBID: | 9wu2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cZ22-Fab in complex with left-handed dC(GC)3 DNA | | Authors: | Lee, C.C., Hsu, S.F., Ko, T.P., Wang, A.H.J. | | Deposition date: | 2025-09-17 |
|
| PDBID: | 9yc0 | | Status: | HPUB -- hold until publication | | Title: | Plasmodium falciparum M17 aminopeptidase (PfA-M17) bound to inhibitor 3ab (MIPS3413) | | Authors: | Mansouri, M., McGowan, S., Webb, C.T. | | Deposition date: | 2025-09-17 |
|
| PDBID: | 9ybo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Trypanosoma cruzi cruzain in complex with boceprevir | | Authors: | Ferreira, P.R., Muniz, J.R.C. | | Deposition date: | 2025-09-17 | | Sequence: | >Entity 1
APAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCDKTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCVSEQLDHGVLLVGYNDSAAVPYWIIKNSWTTQWGEEGYIRIAKGSNQCLVKEEASSAVVG
|
|
| PDBID: | 9spl | | Status: | HOLD -- hold until a certain date | | Title: | D-stereospecific hydrolase I from Bacillus thuringiensis Berliner 1915 | | Authors: | Schoepfel, M., Parthier, C., Bordusa, F., Stubbs, M.T., Simon, A.H. | | Deposition date: | 2025-09-17 | | Release date: | 2026-09-17 |
|
| PDBID: | 9sp7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human galactosyltransferase B3GalT6 | | Authors: | Weyand, M., Unverzagt, C. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9spc | | Status: | HPUB -- hold until publication | | Title: | Recombinant human butyrylcholinesterase in complex with ethyl 1-[3-(2-oxopyrrolidin-1-yl)propyl]-2-phenyl-1H-1,3-benzodiazole-5-carboxylate | | Authors: | Brazzolotto, X., Ha, Z.Y., Law, C.S.W., Yeong, K.Y. | | Deposition date: | 2025-09-16 |
|
| PDBID: | 9y9n | | Status: | HPUB -- hold until publication | | Title: | PLK4 in complex with Compound 25 ((R)-7-hydroxy-N-(3-(1-(2,2,2-trifluoroethyl)-1H-pyrazolo[4,3-c]pyridin-6-yl)-1H-pyrazol-4-yl)-7-(trifluoromethyl)-4-azaspiro[2.5]octane-4-carboxamide) | | Authors: | Murray, J.M., Yang, K.S. | | Deposition date: | 2025-09-14 |
|
| PDBID: | 9wsn | | Status: | HPUB -- hold until publication | | Title: | Tetramer Msp1 from S.cerevisiae (with a catalytic dead mutation) in complex with an unknown peptide substrate | | Authors: | Chengdong, H., Simin, W., Xuan, C. | | Deposition date: | 2025-09-13 |
|
| PDBID: | 9ws4 | | Status: | HPUB -- hold until publication | | Title: | Cyro-EM structure of the ACT-451840-bound PfMDR1 | | Authors: | Zhao, Z., Li, J., Wang, X., Liu, X., Wang, N., Xu, H., Quan, C., Wang, X., Kato, N., Deng, D., Jing, X. | | Deposition date: | 2025-09-12 |
|
| PDBID: | 9wrn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chimeric anti-Z-DNA Fab cZ22-Fab | | Authors: | Lee, C.C., Hsu, S.F., Wang, A.H.J. | | Deposition date: | 2025-09-12 |
|
| PDBID: | 9ws0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cZ22-Fab in complex with left-handed d(CG)6 DNA | | Authors: | Lee, C.C., Hsu, S.F., Ko, T.P., Wang, A.H.J. | | Deposition date: | 2025-09-12 |
|
| PDBID: | 9ws7 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cofactor-free full-length Tau P301S fibrils | | Authors: | Zhang, G., Li, X., Liu, C. | | Deposition date: | 2025-09-12 | | Release date: | 2026-09-12 |
|
| PDBID: | 9wsa | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cofactor-free PHF-like FL-P301S/3R mixed Tau fibrils Type 1 | | Authors: | Zhang, G., Li, X., Liu, C. | | Deposition date: | 2025-09-12 | | Release date: | 2026-09-12 |
|
| PDBID: | 9wsb | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cofactor-free PHF-like FL-P301S/3R mixed Tau fibrils Type 2 | | Authors: | Zhang, G., Li, X., Liu, C. | | Deposition date: | 2025-09-12 | | Release date: | 2026-09-12 |
|
| PDBID: | 9wrc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ZER1 bound to MHGD degron | | Authors: | Dong, C., Ma, J., Li, J. | | Deposition date: | 2025-09-11 | | Release date: | 2026-09-11 |
|
| PDBID: | 9y7v | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis pyruvate dehydrogenase complex E2p core subunit DlaT bound to coenzyme A in a hexamer state | | Authors: | Hsu, H.C., Li, H. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9y7y | | Status: | HPUB -- hold until publication | | Title: | KRAS-specific 24-246 TCR in complex with HLA-C*01:02 presenting KRAS G12V 9mer peptide (11-AVGVGKSAL-19) | | Authors: | Miller, H.A., Palowitch, G.M., Dulberger, C.L. | | Deposition date: | 2025-09-11 |
|
| PDBID: | 9sn9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anthocyanin-related glutathione transferase from bilberry in complex with glutathione | | Authors: | Didierjean, C., Favier, F., Mathiot, S. | | Deposition date: | 2025-09-10 | | Sequence: | >Entity 1
MVVKVYGSIRAACPQRVMVCLLEMGVDFELIPVDLESGEHKKPEFLLRQPFGQVPAIEDGDFRLFESRAIIRYYAAKYADYGPNLLGTTLEERALVDQWLEVEAHNFNDLVYNLVLQLVILPRMGERSDLALVSTCENKLEKVLDIYEQRLSKSNYLAGESFTLADLSHLPAIRYLMDEAGLGHMVRNRKNVNSWWMDISSRPAWKKIMKLMD
|
|
| PDBID: | 9sn8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anthocyanin-related glutathione transferase from bilberry | | Authors: | Didierjean, C., Favier, F., Mathiot, S. | | Deposition date: | 2025-09-10 | | Sequence: | >Entity 1
MVVKVYGSIRAACPQRVMVCLLEMGVDFELIPVDLESGEHKKPEFLLRQPFGQVPAIEDGDFRLFESRAIIRYYAAKYADYGPNLLGTTLEERALVDQWLEVEAHNFNDLVYNLVLQLVILPRMGERSDLALVSTCENKLEKVLDIYEQRLSKSNYLAGESFTLADLSHLPAIRYLMDEAGLGHMVRNRKNVNSWWMDISSRPAWKKIMKLMD
|
|
| PDBID: | 9sn7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anthocyanin-related glutathione transferase from poplar in complex with quercetin | | Authors: | Didierjean, C., Favier, F., Mathiot, S. | | Deposition date: | 2025-09-10 | | Sequence: | >Entity 1
VVKVYGPAMAVCPQRVMACLLEKGVEFDLVHVDLDSGEQKLPEFLLKQPFGQVPVVEDGDFKLFESRAIIRYYAAKYEDRGPNLLGNTLEEKALVDQWLEIEAHNFNDLVFNIVFQVVILPRIGQQGDSELVRTYEEKLEKVLDVYEQRLSKSKYLAGDSFTLADLSHLPATRYLVNEAGLGHLVKDRKKLNAWWEDISSRPAWKKLINLAGF
|
|
| PDBID: | 9y79 | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC^walked) containing mRNA with a 39 nt long spacer, NusG, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Shandilya, S., Wang, C., Molodtsov, V., Ebright, R.H. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y72 | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis pyruvate dehydrogenase complex E2p core subunit DlaT in a two-hexamer state | | Authors: | Hsu, H.C., Li, H. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y6o | | Status: | HPUB -- hold until publication | | Title: | Structure of fimbriae-like lipoprotein by Cryo Electron Microscopy | | Authors: | Hanssen, E., Gorasia, D.G., Reynolds, E.C. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9y6t | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis pyruvate dehydrogenase complex E2p core subunit DlaT in a hexamer state | | Authors: | Hsu, H.C., Li, H. | | Deposition date: | 2025-09-09 |
|
| PDBID: | 9wpb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human transthyretin (TTR) with pryazole-based stabilizer | | Authors: | Choe, J., Choi, S., Shin, H.-C. | | Deposition date: | 2025-09-08 |
|
