PDBID: | 9d9r | Status: | HPUB -- hold until publication | Title: | X-ray structure of ALX4 homeodomain dimer bound to DNA | Authors: | Yuan, Z., Kovall, R.A. | Deposition date: | 2024-08-21 |
|
PDBID: | 9d99 | Status: | HPUB -- hold until publication | Title: | Incorporation of dehydro-aza-proline residues in avian pancreatic polypeptide: prototype sequence | Authors: | Wright, M.M., Rajewski, B.H., Gerrein, T.A., Smith, L.J., Horne, W.S., Del Valle, J.R. | Deposition date: | 2024-08-21 |
|
PDBID: | 9d9i | Status: | HPUB -- hold until publication | Title: | Human Hsp90b nucleotide binding domain in complex with BRI2312 | Authors: | Kuntz, D.A., Prive, G.G. | Deposition date: | 2024-08-21 |
|
PDBID: | 9d9e | Status: | AUTH -- processed, waiting for author review and approval | Title: | Candida albicans Hsp90 nucleotide binding domain in complex with BRI2217 | Authors: | Kuntz, D.A., Prive, G.G. | Deposition date: | 2024-08-21 |
|
PDBID: | 9da1 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human DNPH1 bound to inhibitor 1a | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | Deposition date: | 2024-08-21 | Sequence: | >Entity 1 SMRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADP
|
|
PDBID: | 9da2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human DNPH1 bound to inhibitor 1b | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | Deposition date: | 2024-08-21 | Sequence: | >Entity 1 SMRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADP
|
|
PDBID: | 9d9a | Status: | HPUB -- hold until publication | Title: | Incorporation of dehydro-aza-proline residues in avian pancreatic polypeptide: Aza-Pro substitution at position 4 | Authors: | Wright, M.M., Rajewski, B.H., Gerrein, T.A., Smith, L.J., Horne, W.S., Del Valle, J.R. | Deposition date: | 2024-08-21 |
|
PDBID: | 9d9b | Status: | HPUB -- hold until publication | Title: | Incorporation of dehydro-aza-proline residues in avian pancreatic polypeptide: Aza-Pro substitution at position 6 | Authors: | Wright, M.M., Rajewski, B.H., Gerrein, T.A., Smith, L.J., Horne, W.S., Del Valle, J.R. | Deposition date: | 2024-08-21 |
|
PDBID: | 9d9c | Status: | HPUB -- hold until publication | Title: | Incorporation of dehydro-aza-proline residues in avian pancreatic polypeptide: Aza-Pro substitution at positions 4 and 6 | Authors: | Wright, M.M., Rajewski, B.H., Gerrein, T.A., Smith, L.J., Horne, W.S., Del Valle, J.R. | Deposition date: | 2024-08-21 |
|
PDBID: | 9da3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of human DNPH1 bound to inhibitor 2a | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | Deposition date: | 2024-08-21 |
|
PDBID: | 9da4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human DNPH1 bound to inhibitor 2b | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | Deposition date: | 2024-08-21 | Sequence: | >Entity 1 SMRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADP
|
|
PDBID: | 9da5 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human DNPH1 bound to inhibitor 2c | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | Deposition date: | 2024-08-21 | Sequence: | >Entity 1 SMRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADP
|
|
PDBID: | 9da6 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Crystal structure of human DNPH1 bound to inhibitor 3a | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | Deposition date: | 2024-08-21 |
|
PDBID: | 9d9g | Status: | HPUB -- hold until publication | Title: | Candida albicans Hsp90 nucleotide binding domain in complex with BRI2312 | Authors: | Kuntz, D.A., Prive, G.G. | Deposition date: | 2024-08-21 |
|
PDBID: | 9j85 | Status: | HPUB -- hold until publication | Title: | The complex structure of okaE with a-ketoglutarate | Authors: | Liu, T.H., Yan, W.P. | Deposition date: | 2024-08-20 |
|
PDBID: | 9j7w | Status: | HPUB -- hold until publication | Title: | Channel Rhodospin from Klebsormidium nitens (KnChR) | Authors: | Yuzhu, Z.W., Hiroaki, A., Tatsuki, T., Fumiya, K.S., Wataru, S., Osamu, N. | Deposition date: | 2024-08-20 |
|
PDBID: | 9d8w | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Human Enterovirus D94 A-particle | Authors: | Fu, J., Klose, T., Rossmann, M.R., Kuhn, R., Center for Structural Genomics of Infectious Diseases (CSGID) | Deposition date: | 2024-08-20 |
|
PDBID: | 9d8v | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the BG505 SOSIPv2 | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | Deposition date: | 2024-08-20 | Release date: | 2025-02-26 |
|
PDBID: | 9gio | Status: | HPUB -- hold until publication | Title: | Crystal structure of the VHL-EloC-EloB complex with a covalent compound bound to C77 of VHL. | Authors: | Collie, G.W. | Deposition date: | 2024-08-19 |
|
PDBID: | 9j7h | Status: | HPUB -- hold until publication | Title: | Crystal structure of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase) from Providencia alcalifaciens complexed with quinic acid | Authors: | Jangid, K., Mahto, J.K., Kumar, K.A., Kumar, P. | Deposition date: | 2024-08-19 |
|
PDBID: | 9d89 | Status: | AUTH -- processed, waiting for author review and approval | Title: | E. coli 50S ribosomal subunit in complex with PrAMP rumicidin-2 (focused refinement) | Authors: | Pichkur, E.B., Panteleev, P.V., Konevega, A.L. | Deposition date: | 2024-08-19 |
|
PDBID: | 9d8b | Status: | HPUB -- hold until publication | Title: | High-resolution crystal structure of Vibrio cholerae NFeoB in the GDP-bound form | Authors: | Lee, M., Magante, K.D., Smith, A.T. | Deposition date: | 2024-08-19 |
|
PDBID: | 9d8c | Status: | HPUB -- hold until publication | Title: | OXA-58-NA-1-157 2.5 hour complex | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | Deposition date: | 2024-08-19 | Sequence: | >Entity 1 MKLLKILSLVCLSISIGACAEHSMSRAKTSTIPQVNNSIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRGENRLYAKSGWGMAVDPQVGWYVGFVEKADGQVVAFALNMQMKAGDDIALRKQLSLDVLDKLGVFHYL
|
|
PDBID: | 9d8d | Status: | HPUB -- hold until publication | Title: | Crystal structure of Vibrio cholerae NFeoB in the GMPPCP-bound form | Authors: | Lee, M., Magante, K.D., Smith, A.T. | Deposition date: | 2024-08-19 |
|
PDBID: | 9d7y | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of scFv corresponding to human autoantibody b96.11 | Authors: | Buckle, A.M., McGowan, S. | Deposition date: | 2024-08-18 | Release date: | 2025-08-18 |
|