| PDBID: | 9bcy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Mayaro virus capsid C-terminal domain | | Authors: | Bezerra, E.H.S., Scorsato, V., Tonoli, C.C., Benedetti, C.E., Marques, R.E. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 9eya | | Status: | HPUB -- hold until publication | | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp4/5 substrate peptide (soaking). | | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9eyy | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 1 (strain Mahoney) native conformation stabilised virus-like particle (PV1 SC6b) from a yeast expression system. | | Authors: | Bahar, M.W., Sherry, L., Stonehouse, N.J., Rowlands, D.J., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9exh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the Apo E. coli BrxX methyltransferase | | Authors: | Adams, M.C., Ghilarov, D. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 9exu | | Status: | HPUB -- hold until publication | | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp4/5 substrate peptide (cocrystallization). | | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 9ewz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the E. coli BrxX methyltransferase in complex with DNA | | Authors: | Adams, M.C., Ghilarov, D. | | Deposition date: | 2024-04-05 |
|
| PDBID: | 9ex8 | | Status: | HPUB -- hold until publication | | Title: | Free form of a mutant of SARS-CoV-2 main protease Mpro. | | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | | Deposition date: | 2024-04-05 |
|
| PDBID: | 9ex7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the E. coli BrxX methyltransferase in complex with Ocr | | Authors: | Adams, M.C., Ghilarov, D. | | Deposition date: | 2024-04-05 |
|
| PDBID: | 9ew1 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, CRAF phosphopeptide (pS259) and compound 79 (1124379). | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew3 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide 12-mer (pS259) and compound 78 (1084378) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew4 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide 12mer (pS259) and compound 86 (1124384) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew5 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) 12mer and compound 23 (1083848) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew7 | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3s and CRAF phosphopeptide (pS259) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew6 | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3s and BRAF phosphopeptide (pS365) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9bab | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of Hyper2 tube, ~27 nm diameter | | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 9bac | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of Hyper2 tube, ~24 nm diameter | | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 9b8m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ornithine decarboxylase in complex with a novel inhibitor | | Authors: | Schultz, C.R., Aleiwi, B., Zhou, X.E., Suino-Powell, K., Melcher, K., Brunzelle, J.S., Almeida, N.M.S., Wilson, A.K., Ellsworth, E., Bachmann, A.S. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 9b8n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ornithine decarboxylase in complex with a novel inhibitor (10-S) | | Authors: | Schultz, C.R., Aleiwi, B., Zhou, X.E., Suino-Powell, K., Melcher, K., Brunzelle, J.S., Almeida, N.M.S., Wilson, A.K., Ellsworth, E., Bachmann, A.S. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 8yw3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the retatrutide-bound human GLP-1R-Gs complex | | Authors: | Li, W.Z., Zhou, Q.T., Cong, Z.T., Yuan, Q.N., Li, W.X., Zhao, F.H., Xu, H.E., Zhao, L.H., Yang, D.H., Wang, M.W. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 8yw4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the retatrutide-bound human GIPR-Gs complex | | Authors: | Li, W.Z., Zhou, Q.T., Cong, Z.T., Yuan, Q.N., Li, W.X., Zhao, F.H., Xu, H.E., Zhao, L.H., Yang, D.H., Wang, M.W. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9etx | | Status: | HPUB -- hold until publication | | Title: | KEAP1 BTB in complex with compound 23 | | Authors: | Richardson, W., Bullock, A.N., Rothweiler, E.M., Manning, C.E., Sweeney, M.N., Chalk, R., Huber, K.V.M. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b7d | | Status: | HPUB -- hold until publication | | Title: | Structure of ThsB-Tad3 complex | | Authors: | Hobbs, S.J., Tan, J.M.J., Yirmiya, E., Sorek, R., Kranzusch, P.J. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9esv | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CDK2-cyclin A in complex with FragLite 19 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9et5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CDK2-cyclin A in complex with FragLite 8 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9etp | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 1 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
>Entity 2
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
|
|
