PDBID: | 9byj | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Hck in complex with the Src-family kinase inhibitor A-419259 | Authors: | Selzer, A.M., Alvarado, J.J., Smithgall, T.E. | Deposition date: | 2024-05-23 |
|
PDBID: | 9bye | Status: | HPUB -- hold until publication | Title: | Nanoparticle Crystal Structure of a Thermostabilized Mutant E.coli Ferritin ECFTNA | Authors: | Seraj, N., Cappelli, L., Wahome, N., Cinelli, P., Fabiola, G., Cartocci, E., Harshbarger, W., Delany, I., Cozzi, R. | Deposition date: | 2024-05-23 |
|
PDBID: | 9bxw | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH DL-III-115 | Authors: | Tolbert, W.D., Niu, L., Pazgier, M. | Deposition date: | 2024-05-23 |
|
PDBID: | 9bxy | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH DL-III-117 | Authors: | Tolbert, W.D., Niu, L., Pazgier, M. | Deposition date: | 2024-05-23 |
|
PDBID: | 9by4 | Status: | HPUB -- hold until publication | Title: | Co-crystal structure of the kinase domain of EGFR with non-covalent osimertinib | Authors: | Ashtekar, K.D., Stayrook, S.E., Lemmon, M.A. | Deposition date: | 2024-05-23 |
|
PDBID: | 9by6 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the kinase domain of EGFR soaked with non-covalent osimertinib | Authors: | Ashtekar, K.D., Stayrook, S.E., Lemmon, M.A. | Deposition date: | 2024-05-23 |
|
PDBID: | 9ff6 | Status: | HPUB -- hold until publication | Title: | Human transthyretin (TTR) in complex with (E)-4-((((2-methoxybenzyl)oxy)imino)methyl)benzoic acid (Lic157) | Authors: | Ciccone, L., Shepard, W., Sirigu, S., Camodeca, C., Mazzoccchi, F., Fruchart, C., Nencetti, S., Orlandini, E. | Deposition date: | 2024-05-22 |
|
PDBID: | 9ff8 | Status: | HPUB -- hold until publication | Title: | Human transthyretin (TTR) in complex with (E)-2-((((2-chlorobenzyl)oxy)imino)methyl)benzoic acid (Lic166) | Authors: | Ciccone, L., Shepard, W., Sirigu, S., Camodeca, C., Mazzoccchi, F., Fruchart, C., Nencetti, S., Orlandini, E. | Deposition date: | 2024-05-22 |
|
PDBID: | 9bxp | Status: | HPUB -- hold until publication | Title: | Nanoparticle Crystal Structure of a Thermostabilized Mutant of an As-Isolated FtnA (Ferritin) from Pseudomonas aeruginosa | Authors: | Seraj, N., Cappelli, L., Wahome, N., Cinelli, P., Fabiola, G., Cartocci, E., Delany, I., Cozzi, R. | Deposition date: | 2024-05-22 |
|
PDBID: | 9bxb | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH DL-III-14 | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | Deposition date: | 2024-05-22 |
|
PDBID: | 9bxd | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH HZ-IV-188 | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | Deposition date: | 2024-05-22 |
|
PDBID: | 9bxf | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH HZ-IV-236 | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | Deposition date: | 2024-05-22 |
|
PDBID: | 9bxg | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH HZ-IV-242 | Authors: | Tolbert, W.D., Niu, L., Pazgier, M. | Deposition date: | 2024-05-22 |
|
PDBID: | 9bwn | Status: | HPUB -- hold until publication | Title: | Nanoparticle Crystal Structure of a Thermostabilized Mutant Rv1498A Flavoprotein from Mycobacterium tuberculosis | Authors: | Seraj, N., Cappelli, L., Wahome, N., Cinelli, P., Fabiola, G., Cartocci, E., Delany, I., Cozzi, R. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwe | Status: | HPUB -- hold until publication | Title: | Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine at pH 6.4 in an intermediate state | Authors: | Kindig, K., Gibbs, E., Chakrapani, S. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwj | Status: | HPUB -- hold until publication | Title: | Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine and 0.1 mM zinc in an apo state | Authors: | Kindig, K., Gibbs, E., Chakrapani, S. | Deposition date: | 2024-05-21 |
|
PDBID: | 9bwm | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Oxidized Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-21 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bwq | Status: | HPUB -- hold until publication | Title: | X-ray Counterpart to the Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-21 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bwr | Status: | HPUB -- hold until publication | Title: | X-ray Counterpart to the Neutron Structure of Reduced Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-21 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bvy | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-20 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bw2 | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Reduced Tyr34Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-05-20 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 9bu4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of an MKP5 mutant, Y435W, in complex with an allosteric inhibitor | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | Deposition date: | 2024-05-16 |
|
PDBID: | 9bqk | Status: | HPUB -- hold until publication | Title: | Crystal structure of HLA*02:01 with the 11-mer TP53 peptide GLAPPQHLIRV | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | Deposition date: | 2024-05-10 |
|
PDBID: | 9bqu | Status: | HPUB -- hold until publication | Title: | Crystal structure of HLA*02:01 with the 11-mer TP53 mutant peptide GLAPPQHLFRV | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | Deposition date: | 2024-05-10 |
|
PDBID: | 9f8y | Status: | HPUB -- hold until publication | Title: | Crystal structure of a designed three-motif Respiratory Syncytial Virus immunogen | Authors: | Castro, K.M., Correia, B.E. | Deposition date: | 2024-05-07 |
|