Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9x1u
Status:HPUB -- hold until publication
Title:Crystal structure of the Y393A FMNH2-dependent monooxygenase in complex with Diethylene glycol
Authors:Lee, C., Kim, D., Ka, S., Park, S., Phan, H.T.L., Oh, J.
Deposition date:2025-10-03
PDBID:9x1s
Status:HPUB -- hold until publication
Title:Crystal structure of the wild-type FMNH2-dependent monooxygenase in complex with FMN and Diethylene glycol
Authors:Lee, C., Kim, D., Ka, S., Park, S., Phan, H.T.L., Oh, J.
Deposition date:2025-10-03
PDBID:9sv8
Status:HPUB -- hold until publication
Title:Herpes simplex virus 2 delta28-73 glycoprotein C ectodomain in complex with C3b
Authors:Rojas Rechy, M.H., Atanasiu, D., Hook, L.M., Cairns, M.T., Saw, W.T., Cahill, A., Guo, Z., Calabrese, A.N., Ranson, N.A., Friedman, H.M., Cohen, G.H., Fontana, J.
Deposition date:2025-10-02
PDBID:9yip
Status:HPUB -- hold until publication
Title:Crystal structure of human IL-8 in a large unit cell
Authors:Lodowski, D.T., Chapman, P.Q.
Deposition date:2025-10-02
Sequence:

>Entity 1


SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSHHHHHH
PDBID:9yiy
Status:HPUB -- hold until publication
Title:Crystal structure of mouse coatomer beta2-WD40 domain in complex with MHV spike tail hepta-peptide
Authors:Dey, D., Shakya, A.K., Hasan, S.S.
Deposition date:2025-10-02
PDBID:9sv6
Status:HPUB -- hold until publication
Title:CryoEM structure of transcribing RNA polymerase II elongation complex with ATP and Elf1
Authors:Yi, G., Li, Q., Wang, D., Zhang, P.
Deposition date:2025-10-01
PDBID:9x12
Status:HPUB -- hold until publication
Title:Dimeric amylosucrase from Deinococcus geothermalis with 4''-hydroxyflavone
Authors:Kim, D.S., Park, J.H., Seo, D.
Deposition date:2025-10-01
Sequence:

>Entity 1


TSELAAQVRDAFDDDRDAETFLLRLERYGEDLWESLRAVYGDQVRALPGRLLEVMLHAYHARPAELRRLDEARLLRPDWLQRPEMVGYVAYTDRFAGTLKGVEERLDYLEGLGVKYLHLMPLLRPREGENDGGYAVQDYRAVRPDLGTMDDLSALARALRGRGISLVLDLVLNHVAREHAWAQKARAGDPKYRAYFHLFPDRRGPDAFEATLPEIFPDFAPGNFSWDEEIGEGEGGWVWTTFNSYQWDLNWANPDVFLEFVDIILYLANRGVEVFRLDAIAFIWKRLGTDCQNQPEVHHLTRALRAAARIVAPAVAFKAEAIVAPADLIHYLGTRAHHGKVSDMAYHNSLMVQLWSSLASRNTRLFEEALRAFPPKPTSTTWGLYVRCHDDIGWAISDEDAARAGLNGAAHRHFLSDFYSGQFPGSFARGLVFQYNPVNGDRRISGSAASLAGLEAALETGDPGRIEDAVRRLLLLHTVILGFGGVPLLYMGDELALLNDYAFEDVPEHAPDNRWVHRPQMDWALAERVRQEPSSPAGRVNTGLRHLLRVRRDTPQLHASIESQVLPSPDSRALLLRRDHPLGGMVQVYNFSEETVMLPSHVLRDVLGDHVQDRLSGSAFRLDRPTVRLEGYRALWLTAGEP
PDBID:9x0z
Status:HOLD -- hold until a certain date
Title:Cryo-EM structure of apo Type III restriction-modification system M.FisAW1III-R.FisAW1III complex from Fervidobacterium islandicum AW-1
Authors:Yoo, Y.K., Sung, J.Y., Chang, N.P., Lee, D.W., Cho, H.Y.
Deposition date:2025-10-01
Release date:2026-10-01
PDBID:9sv4
Status:HPUB -- hold until publication
Title:The ternary complex of human sirt6, ADPr and small molecule activator.
Authors:Moche, M., Andersson, O., Nyman, T., Strandback, E., Ampah-Korsah, H., Colquhoun, D., Spahr, H.
Deposition date:2025-09-30
PDBID:9sum
Status:AUTH -- processed, waiting for author review and approval
Title:CryoEM structure of Candida auris 80S ribosome in complex with Cycloheximide and Geneticin G418
Authors:Atamas, A., Stetsenko, A., Incarnato, D., Macia Valero, A., Rogachev, A., Billerbeck, S., Guskov, A.
Deposition date:2025-09-29
PDBID:9suq
Status:HPUB -- hold until publication
Title:Crystal structure of the zymogen of cathepsin D from Schistosoma mansoni
Authors:Busa, M., Brynda, J., Houstecka, R., Hanova, I., Mares, M.
Deposition date:2025-09-29
PDBID:9yh2
Status:AUTH -- processed, waiting for author review and approval
Title:holo-carrier bound/unbound type II thioesterase
Authors:Littler, D.R.
Deposition date:2025-09-29
PDBID:9ygi
Status:HPUB -- hold until publication
Title:Cryo-EM structure of L9-21 in complex with Plasmodium falciparum circumsporozoite protein (PfCSP)
Authors:Tripathi, P., Morano, N.C., Shapiro, L., Kwong, P.D.
Deposition date:2025-09-29
PDBID:9wzf
Status:HOLD -- hold until a certain date
Title:Crystal structure of neuroserpin with a druggable pocket
Authors:Akai, D., Onda, M., Mikami, B.
Deposition date:2025-09-29
Release date:2026-09-29
Sequence:

>Entity 1


MAHHHHHHSAATGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETM
PDBID:9wz5
Status:HPUB -- hold until publication
Title:Full-length ASC-CARD filament
Authors:Xue, D., Ni, F., Liu, S., Yan, H., Luo, Z., Fu, G., Wang, Q., Ma, J.
Deposition date:2025-09-29
PDBID:9wz6
Status:AUTH -- processed, waiting for author review and approval
Title:Full-length Caspase-1-CARD filament
Authors:Xue, D., Ni, F., Liu, S., Yan, H., Luo, Z., Fu, G., Wang, Q., Ma, J.
Deposition date:2025-09-29
PDBID:9suj
Status:HPUB -- hold until publication
Title:Cryo-EM structure of ScV-L-BC
Authors:Novoa, G., Gil-Cantero, D., Caston, J.R.
Deposition date:2025-09-28
PDBID:9ygh
Status:HPUB -- hold until publication
Title:Cryo-EM structure of L9-F4 in complex with Plasmodium falciparum circumsporozoite protein (PfCSP)
Authors:Tripathi, P., Kwong, P.D.
Deposition date:2025-09-28
PDBID:9sui
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-001
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9stb
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-005
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9stc
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-011
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9std
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-013
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9ste
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-026
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9stf
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-028
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27
PDBID:9stg
Status:WAIT -- processing started, waiting for author input to continue processing
Title:High Throughput Crystallography to Combat Antibiotic Resistance - VIM2 with compound MB-073
Authors:Wang, D.Y., Brem, J., Collins, P.M., vonDelft, F., Allen, M.D., Schofield, C.J.
Deposition date:2025-09-27
Release date:2026-09-27

245663

PDB entries from 2025-12-03

PDB statisticsPDBj update infoContact PDBjnumon