Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9umf
Status:HPUB -- hold until publication
Title:Human poly ADP-ribose polymerase(PARP-1 )zinc finger 1 bound to 17bp DNA
Authors:Yan, M., Zhang, H.
Deposition date:2025-04-21
PDBID:9ulr
Status:HPUB -- hold until publication
Title:Recombinant Human Serum Albumin protein 1
Authors:Xiang, W., Yue, Z.L., Su, J.Y.
Deposition date:2025-04-21
PDBID:9ul1
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of Tibetan wild boar SLA-1*Z0301 for 2.32 angstrom
Authors:Fan, S., Wang, Y.
Deposition date:2025-04-18
PDBID:9uj5
Status:HPUB -- hold until publication
Title:Crystal structure of SME-1 E166A in complex with cefprozil
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9uj6
Status:HPUB -- hold until publication
Title:Crystal structure of SME-1 E166A in complex with cefsulodin
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9uj9
Status:HPUB -- hold until publication
Title:Crystal structure of SME-1 E166A in complex with cefotaxime
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9uj7
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of SME-1 E166A in complex with cefoperazone
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9ujb
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of SME-1 E166A in complex with Ceftobiprole
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9ujc
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of SME-1 E166A with cefpirome
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9uk2
Status:AUTH -- processed, waiting for author review and approval
Title:Human OXGR1-miniGq complex (conformation 1)
Authors:Wang, C., Liu, H.
Deposition date:2025-04-17
PDBID:9uj8
Status:HPUB -- hold until publication
Title:Crystal structure of SME-1 E166A with cefovecin
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9uja
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of SME-1 E166A with cefotetan
Authors:Dhankhar, K., Hazra, S.
Deposition date:2025-04-17
PDBID:9uir
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the prostaglandin D2 receptor 1 (DP1) bound to the antagonist laropiprant resolved via the fusion/crosslinking strategy
Authors:Han, S.C., Li, M.H.
Deposition date:2025-04-16
PDBID:9uis
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the prostaglandin D2 receptor 1 (DP1) bound to the antagonist asapiprant resolved via the fusion/crosslinking strategy
Authors:Han, S.C., Li, M.H.
Deposition date:2025-04-16
PDBID:9o8u
Status:HPUB -- hold until publication
Title:(1-methylalkyl)succinate synthase alpha-beta-gamma-delta complex with bound fumarate
Authors:Andorfer, M.C., Drennan, C.L.
Deposition date:2025-04-16
PDBID:9qxz
Status:HPUB -- hold until publication
Title:Structure of human NONO bound to (R)-SKBG-1 in p212121
Authors:Fribourg, S., Fribourg, S.
Deposition date:2025-04-16
PDBID:9qy4
Status:HPUB -- hold until publication
Title:GT108 family enzyme from Chlamydia abortus in complex with mannose-1-phosphate (M1P)
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-16
PDBID:9o84
Status:HPUB -- hold until publication
Title:Structure of turkey hemoglobin A at 1.7 Angstrom resolution (tetragonal form)
Authors:Bingman, C.A., Yin, J., Smith, R.W., Richards, M.P.
Deposition date:2025-04-15
PDBID:9uhf
Status:AUTH -- processed, waiting for author review and approval
Title:JN.1 RBD in complex with antibody BA5-12
Authors:Yue, C., Mao, X.
Deposition date:2025-04-14
PDBID:9uhg
Status:AUTH -- processed, waiting for author review and approval
Title:JN.1 RBD in complex with antibody BA5-12-CDR1
Authors:Yue, C., Mao, X.
Deposition date:2025-04-14
PDBID:9uh9
Status:HPUB -- hold until publication
Title:human Ribonuclease MRP state 1
Authors:Zhou, B., Lan, P., Wu, J., Lei, M.
Deposition date:2025-04-14
PDBID:9uho
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:JN.1 Spike in complex with antibody BA5-39
Authors:Yue, C., Mao, X.
Deposition date:2025-04-14
PDBID:9uhq
Status:AUTH -- processed, waiting for author review and approval
Title:Local refinement of JN.1 spike in complex with antibody BA5-39
Authors:Yue, C., Mao, X.
Deposition date:2025-04-14
PDBID:9qwl
Status:HPUB -- hold until publication
Title:Hemolysin-coregulated-protein-1 (Hcp1) from Bacteroides fragilis strain NCTC9343
Authors:Sauer, U.H., Cisneros, D.A.
Deposition date:2025-04-14
Sequence:

>Entity 1


(MSE)AFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILEN(MSE)TNQFKPHSGSIVFKKGDEEAK(MSE)KELTWENGYITEFTENIDIVGSQP(MSE)TITFVVSAQVIKIGGAQFEQNWPKASGGGHHHHHH
PDBID:9qvy
Status:HPUB -- hold until publication
Title:Nostoc sp. 3335mg GT108 family enzyme complex with mannose-1-phosphate (M1P)
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-13

237992

PDB entries from 2025-06-25

PDB statisticsPDBj update infoContact PDBjnumon