| PDBID: | 9jr0 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | GABA-DGABAB-Gi-complex | | Authors: | shen, C.S., liu, J.F. | | Deposition date: | 2024-09-28 |
|
| PDBID: | 9jql | | Status: | HOLD -- hold until a certain date | | Title: | The C-terminal structure of N6-methyladenosine deaminase | | Authors: | Xie, W., Jia, Q. | | Deposition date: | 2024-09-27 | | Release date: | 2025-09-27 |
|
| PDBID: | 9jq7 | | Status: | HPUB -- hold until publication | | Title: | Calcium-free C2 domain protein from Heimdallarchaeia | | Authors: | Chongrungreang, T., Robinson, R.C. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsg | | Status: | PROC -- to be processed | | Title: | Crystal structure of the SARS-CoV-2 RBD in complex with the cow antibody P2 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsh | | Status: | PROC -- to be processed | | Title: | Crystal structure of the cow antibody P7 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsi | | Status: | PROC -- to be processed | | Title: | Crystal structure of the cow antibody 99 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsj | | Status: | PROC -- to be processed | | Title: | Crystal structure of the cow antibody 105 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9dsk | | Status: | PROC -- to be processed | | Title: | Crystal structure of the cow antibody 115 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 |
|
| PDBID: | 9gvx | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1e conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gvy | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1m conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gvz | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1j conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gw0 | | Status: | HPUB -- hold until publication | | Title: | M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1l conjugate | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-09-26 | | Sequence: | >Entity 1
GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
|
|
| PDBID: | 9gw1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of alpha-carboxysome T=4 mini-shell containing CTD only mutant of CsoSCA | | Authors: | Ng, P.C., Basle, A., Marles-Wright, J., Liu, L. | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9drt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex of M. tuberculosis PheRS with cognate precursor tRNA and fragment DDD00805735 | | Authors: | Chang, C., Michalska, K., Forte, B., Baragana, B., Gilbert, I.H., Wower, J., Joachimiak, A., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-09-26 |
|
| PDBID: | 9jp4 | | Status: | HPUB -- hold until publication | | Title: | Calcium-bound form of C2 domain protein from Candidatus Prometheoarchaeum syntrophicum | | Authors: | Chongrungreang, T., Robinson, R.C. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9drk | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of Mycobacterium tuberculosis biotin protein ligase in complex with Bio-1 | | Authors: | McCue, W.M., Jayasinghe, Y.P., Aldrich, C.C., Ronning, D.R. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9drn | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of Mycobacterium tuberculosis biotin protein ligase in complex with Bio-4 | | Authors: | McCue, W.M., Jayasinghe, Y.P., Aldrich, C.C., Ronning, D.R. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9gvh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Napin from Iberis umbellata L. | | Authors: | Saeed, A., Betzel, C., Brognaro, H., Alves Franca, B., Mehmood, S., Rajaiah Prabhu, P., Ishaq, U., Akrem, A. | | Deposition date: | 2024-09-24 |
|
| PDBID: | 9jny | | Status: | HPUB -- hold until publication | | Title: | C recatived protein pentamer | | Authors: | Li, Y.J. | | Deposition date: | 2024-09-24 |
|
| PDBID: | 9jo3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human BKca channel-compound 10b complex | | Authors: | Kim, S., Park, S., Lee, N.Y., Lee, E.Y., Lee, N., Roh, E.C., Kim, Y.G., Kim, H.J., Jin, M.S., Park, C.S., Kim, Y.C. | | Deposition date: | 2024-09-24 |
|
| PDBID: | 9jo4 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human BKca channel-compound 51b complex | | Authors: | Kim, S., Park, S., Lee, N.Y., Lee, E.Y., Lee, N., Roh, E.C., Kim, Y.G., Kim, H.J., Jin, M.S., Park, C.S., Kim, Y.C. | | Deposition date: | 2024-09-24 |
|
| PDBID: | 9joe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Calcium-bound form of a C2-domain protein from Heimdallarchaeia | | Authors: | Chongrungreang, T., Robinson, R.C. | | Deposition date: | 2024-09-24 |
|
| PDBID: | 9dqp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo-HrmJ from Streptomyces sp. Ag109_G2-6 (HrmJ-ssa) | | Authors: | Zheng, Y.-C., Chang, W.-C. | | Deposition date: | 2024-09-24 |
|
| PDBID: | 9dqr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HrmJ from Streptomyces sp. Ag109_G2-6 (HrmJ-ssa) complexed with vanadyl(IV)-oxo and succinate | | Authors: | Zheng, Y.-C., Chang, W.-C. | | Deposition date: | 2024-09-24 |
|
| PDBID: | 9dqq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HrmJ from Streptomyces sp. Ag109_G2-6 (HrmJ-ssa) complexed with ferric iron(III) and 2-oxoglutarate | | Authors: | Zheng, Y.-C., Chang, W.-C. | | Deposition date: | 2024-09-24 |
|
