Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:8vck
Status:HPUB -- hold until publication
Title:Galactose-binding lectin from Mytilus californianus, Isoform 1 (rMcL-1)
Authors:Hernandez-Santoyo, A., Loera-Rubalcava, J.
Deposition date:2023-12-14
Sequence:

>Entity 1


GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
PDBID:8vcp
Status:HPUB -- hold until publication
Title:Crystal structure of dimeric rMcL-1 in complex with raffinose
Authors:Hernandez-Santoyo, A., Loera-Rubalcava, J.
Deposition date:2023-12-14
Sequence:

>Entity 1


GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
PDBID:8rfi
Status:HPUB -- hold until publication
Title:Ternary complex of HER2/ErbB2 extracellular domain (ECD) in compact conformation with trastuzumab (TZB) antibody
Authors:Gragera, M., Buschiazzo, A., Vacca, S.
Deposition date:2023-12-12
PDBID:8vah
Status:HPUB -- hold until publication
Title:E.coli PNPase in complex with single 8-oxoG RNA
Authors:Kim, W., Zhang, Y.J.
Deposition date:2023-12-11
PDBID:8vak
Status:HPUB -- hold until publication
Title:E.coli PNPase in complex with double 8-oxoG RNA
Authors:Kim, W., Zhang, Y.J.
Deposition date:2023-12-11
PDBID:8vb3
Status:HPUB -- hold until publication
Title:Dienelactone hydrolase from Solimonas fluminis
Authors:Schnettler Fernandez, J.D.F., Campbell, E.C., Hollfelder, F.
Deposition date:2023-12-11
PDBID:8xch
Status:HPUB -- hold until publication
Title:Structural basis for template-product RNA duplex unwinding by SARS-CoV-2 helicase
Authors:Yan, L., Lou, Z.
Deposition date:2023-12-09
PDBID:8xca
Status:HPUB -- hold until publication
Title:Cryo-EM structure of Cas12j19,crRNA and target DNA complex
Authors:Xi, Z.
Deposition date:2023-12-08
PDBID:8xcc
Status:HPUB -- hold until publication
Title:Cryo-EM structure of Cas12j19 (E100K), crRNA and target DNA complex
Authors:Xi, Z.
Deposition date:2023-12-08
PDBID:8rby
Status:HPUB -- hold until publication
Title:The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the neutralizing nanobody 1.26
Authors:Casasnovas, J.M., Fernandez, L.A., Silva, K.
Deposition date:2023-12-05
PDBID:8rap
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of Sen1-ADP.BeF3 bound RNA Polymerase II pre-termination complex
Authors:Rengachari, S., Lidscreiber, M., Cramer, P.
Deposition date:2023-12-01
PDBID:8ran
Status:HPUB -- hold until publication
Title:Structure of Sen1-RNA complex
Authors:Rengachari, S., Lidscreiber, M., Cramer, P.
Deposition date:2023-12-01
PDBID:8rao
Status:HPUB -- hold until publication
Title:Structure of Sen1-ADP.BeF3-RNA complex
Authors:Rengachari, S., Lidscreiber, M., Cramer, P.
Deposition date:2023-12-01
PDBID:8v2w
Status:HPUB -- hold until publication
Title:Crystal Structure of the ancestral triosephosphate isomerase reconstruction of the last opisthokont common ancestor obtained by Bayesian inference
Authors:Perez-Nino, J.A., Rodriguez-Romero, A., Guerra, Y., Fernandez-Velasco, D.A.
Deposition date:2023-11-24
PDBID:8v2x
Status:HPUB -- hold until publication
Title:Crystal Structure of the reconstruction of the worst case of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by bayesian inference
Authors:Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A.
Deposition date:2023-11-24
PDBID:8x6j
Status:HPUB -- hold until publication
Title:The X-ray structure of N-terminal catalytic domain of Thermoplasma acidophilum tRNA methyltransferase Trm56 (Ta0931) in complex with S-adenosyl-L-methionine
Authors:Fukumoto, S., Hasegawa, T., Ototake, M., Moriguchi, S., Namba, M., Yamagamai, R., Kawamura, T., Hirata, A., Hori, H.
Deposition date:2023-11-21
PDBID:8v19
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:RNA polymerase II elongation complex with Syn conformation 8-oxoguanine with AMP added
Authors:Oh, J., Wang, D.
Deposition date:2023-11-20
PDBID:8v1a
Status:HPUB -- hold until publication
Title:RNA polymerase II elongation complex with 8-oxoguanine and ATP in two different conformation: 8OG (syn)-ATP (A site) and 8OG (anti)-ATP (E site)
Authors:Oh, J., Wang, D.
Deposition date:2023-11-20
PDBID:8v18
Status:HPUB -- hold until publication
Title:RNA polymerase II elongation complex with 8-oxoguanine with bound AMPCPP
Authors:Oh, J., Wang, D.
Deposition date:2023-11-20
PDBID:8v0a
Status:HPUB -- hold until publication
Title:Crystal Structure of the worst case of the reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood with PGH
Authors:Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A.
Deposition date:2023-11-17
PDBID:8uzq
Status:HPUB -- hold until publication
Title:RNA polymerase II elongation complex with 8-oxoguanine in +1 active site
Authors:Oh, J., Wang, D.
Deposition date:2023-11-16
PDBID:8uzr
Status:HPUB -- hold until publication
Title:RNA polymerase II elongation complex with 8-oxoguanine with bound CMPCPP
Authors:Oh, J., Wang, D.
Deposition date:2023-11-16
PDBID:8uzs
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:RNA polymerase II elongation complex with 8-oxoguanine with 3'' CTP added
Authors:Oh, J., Wang, D.
Deposition date:2023-11-16
PDBID:8uy5
Status:HPUB -- hold until publication
Title:[ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides
Authors:Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C.
Deposition date:2023-11-13
PDBID:8r3m
Status:HPUB -- hold until publication
Title:Mycobacterium smegnatis RNA polymerase transcription initiation complex with SigmaA, RbpA, HelD N-terminal, CO and PCh loop domain, and an upstream-fork promoter fragment; State III conformation
Authors:Koval, T., Krasny, L., Dohnalek, J., Kouba, T.
Deposition date:2023-11-09

223532

PDB entries from 2024-08-07

PDB statisticsPDBj update infoContact PDBjnumon