| PDBID: | 9oj2 | | Status: | AUCO -- author corrections pending review | | Title: | sx20S complex (NSF-alphaSNAP-syntaxin-1a), non-hydrolyzing, class 1 | | Authors: | White, K.I., Brunger, A.T. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9r3p | | Status: | HPUB -- hold until publication | | Title: | Hemoglobin Glb2-1 of Lotus japonicus (cyano-ferric form) | | Authors: | Martinez-Julvez, M., Becana, M., Villar, I. | | Deposition date: | 2025-05-05 |
|
| PDBID: | 9r3j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human MAO B in complex with (E)-3-(benzo[d][1,3]dioxol-5-yl)-1-(3-(trifluoromethyl)phenyl)prop-2-en-1-one (chalcone inhibitor, 4e) | | Authors: | Marchese, S., Binda, C. | | Deposition date: | 2025-05-05 |
|
| PDBID: | 9r3k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human MAO B in complex with ((E)-3-(3-nitrophenyl)-1-(3-(trifluoromethyl)phenyl)prop-2-en-1-one (4b) | | Authors: | Marchese, S., Binda, C. | | Deposition date: | 2025-05-05 |
|
| PDBID: | 9ogp | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein HCV-1 E2ecto from genotype 1a bound to neutralizing antibody K579 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-05-01 |
|
| PDBID: | 9ogt | | Status: | HPUB -- hold until publication | | Title: | HIV-1 Env BG505 SOSIP.664-His in complex with PGT122 and 3BNC117 Fabs | | Authors: | Andrade, T.G., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-05-01 |
|
| PDBID: | 9ogu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HIV-1 Env BG505 SOSIP.664-dPG-His in complex with PGT122 and 3BNC117 Fabs | | Authors: | Andrade, T.G., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-05-01 |
|
| PDBID: | 9urj | | Status: | HPUB -- hold until publication | | Title: | binary complex of polyP-bound polyphosphate kinase 1 (PPK1) | | Authors: | Jiang, W.J., Zhao, J., Wei, W. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9uri | | Status: | HPUB -- hold until publication | | Title: | apo form of polyphosphate kinase 1 (PPK1) | | Authors: | Jiang, W.J., Zhao, J., Wei, W. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9ogd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human exportin-1 conjugated with KPT-185 and bound to human ASB8(R197A)-ELOB/C | | Authors: | Wing, C.E., Fung, H.Y.J., Chook, Y.M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9og7 | | Status: | HPUB -- hold until publication | | Title: | APO SARS-COV-2-6P-MUT7 S PROTEIN 1 RBD UP CONFORMATION | | Authors: | Niu, L., Chandravanshi, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9og5 | | Status: | HPUB -- hold until publication | | Title: | SARS-COV-2-6P-MUT7 S PROTEIN-DY-III-281 complex 1 RBD up conformation | | Authors: | Chandravanshi, M., Niu, L., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9r2j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human MAO B in complex with (E)-3-(4-nitrophenyl)-1-(3-(trifluoromethyl)phenyl)prop-2-en-1-one (chalcone inhibitor, 4a) | | Authors: | Marchese, S., Binda, C. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9uqd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of connexin-30 intercellular gap junction channel at 3.1 angstrom resolution by cryoEM | | Authors: | Hou, M.Z., Hou, M.Z. | | Deposition date: | 2025-04-29 | | Release date: | 2026-04-29 |
|
| PDBID: | 9r1c | | Status: | HPUB -- hold until publication | | Title: | Keap1 - inhibitor complex - 1 | | Authors: | Talapatra, S.K., Kozielski, F., Wells, G. | | Deposition date: | 2025-04-26 |
|
| PDBID: | 9unu | | Status: | HPUB -- hold until publication | | Title: | PSI-1 FCPI supercomplex from haptophyte Chrysotila roscoffensis | | Authors: | La Rocca, R., Tsai, P.-C., Kato, K., Nakajima, Y., Akita, F., Shen, J.-R. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9ocn | | Status: | HPUB -- hold until publication | | Title: | PC68_L31_570 Fab in complex with HIV-1 Env BG505 SOSIP.664 and RM20A3 Fab | | Authors: | Ozorowski, G., Torres, J.L., Ward, A.B. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9ock | | Status: | HPUB -- hold until publication | | Title: | Co-Structure of Main Protease of SARS-CoV-2 with Compound 1 | | Authors: | Knapp, M.S., Ornelas, E. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r0w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glutathione transferase iota 1 from Synechocystis sp. PCC 6803 in complex with FMN | | Authors: | Didierjean, C., Hecker, A., Morette, L. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r0q | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Paraoxonase-1 in complex with terbium(III) and 2-hydroxyquinoline | | Authors: | Smerkolj, J., Pavsic, M., Golicnik, M. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r0x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 with thiol compound 14a | | Authors: | Hinchliffe, P., Spencer, J. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9r0y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 with thiol compound 22b | | Authors: | Hinchliffe, P., Spencer, J. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9qzl | | Status: | HPUB -- hold until publication | | Title: | Structure of NONO bound to (R)-SKBG-1 in P43212 | | Authors: | Fribourg, S. | | Deposition date: | 2025-04-23 |
|
| PDBID: | 9obi | | Status: | HPUB -- hold until publication | | Title: | Room Temperature X-Ray Structure of HIV-1 Protease in Complex with Inhibitor GRL-075-24A | | Authors: | Bhandari, D., Kovalevsky, A., Ghosh, A.K. | | Deposition date: | 2025-04-22 | | Sequence: | >Entity 1
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
| PDBID: | 9umc | | Status: | HPUB -- hold until publication | | Title: | Human poly ADP-ribose polymerase(PARP-1 )zinc finger 1 bound to 13bp DNA | | Authors: | Yan, M., Zhang, H. | | Deposition date: | 2025-04-21 |
|
