| PDBID: | 9dtd | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of C2-01018 | | Authors: | Bera, A.K., Schlichthaerle, T., Kang, A., Baker, D. | | Deposition date: | 2024-09-30 |
|
| PDBID: | 9jp5 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Phthalate 3,4-dioxygenase from Rhodococcus jostii RHA1 | | Authors: | Kumar, K.A., Pahwa, D., Kumar, P. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9jp7 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | 4,5-dihydroxyphthalate decarboxylase from Comamonas testosteroni (strain DSM 14576 / KF-1) | | Authors: | Kumar, K.A., Pahwa, D., Kumar, P. | | Deposition date: | 2024-09-25 |
|
| PDBID: | 9dm3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | De novo design of proteins that bind naphthalenediimides, powerful photooxidants with tunable photophysical properties | | Authors: | Wu, Y., Mann, S.I., DeGrado, W.F. | | Deposition date: | 2024-09-12 |
|
| PDBID: | 9gcq | | Status: | HPUB -- hold until publication | | Title: | Human Butyrylcholinesterase in complex with N1,N1-dimethyl-N2-(6-(naphthalen-2-yl)-5-(pyridin-4-yl)pyridazin-3-yl)ethane-1,2-diamine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcr | | Status: | HPUB -- hold until publication | | Title: | Human Butyrylcholinesterase in complex with N1,N1-dimethyl-N2-(6-(naphthalen-1-yl)-5-(pyridin-4-yl)pyridazin-3-yl)ethane-1,2-diamine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9ioy | | Status: | HPUB -- hold until publication | | Title: | Isophthalate dioxygenase in complex with isophthalate | | Authors: | Jangid, K., Mahto, J.K., Kumar, P. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ina | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of isophthalate dioxygenase from Comamonas testosteroni KF1 | | Authors: | Mahto, J.K., Kumar, P. | | Deposition date: | 2024-07-06 |
|
| PDBID: | 9fxz | | Status: | HPUB -- hold until publication | | Title: | Galectin-8 N-terminal carbohydrate recognition domain in complex with 4-(bromophenyl)phthalazinone D-galactal ligand | | Authors: | Van Klaveren, S., Hakansson, M., Diehl, C., Nilsson, N.J. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9frp | | Status: | HPUB -- hold until publication | | Title: | Human PARP10 ART domain bound to a phthalazinone-based inhibitor. | | Authors: | Moche, M., Upadhayaya, K., Cohen, M.S., Schuler, H. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frs | | Status: | HPUB -- hold until publication | | Title: | Human PARP10 ART domain bound to a phthalazinone-based inhibitor | | Authors: | Moche, M., Upadhyaya, K., Cohen, M.S., Schuler, H. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 8znq | | Status: | HOLD -- hold until a certain date | | Title: | Solution structure of the complex of naphthyridine-azaquinolone and an RNA with ACG/AUA motif | | Authors: | Fujiwara, A., Chen, Q., Nakatani, K., Murata, A., Kawai, G. | | Deposition date: | 2024-05-27 | | Release date: | 2025-05-27 |
|
| PDBID: | 7h60 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.875 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 3-[[ethoxycarbonyl(methyl)amino]methyl]-5-fluoro-1-(naphthalen-1-ylmethyl)indole-2-carboxylic acid - ZN CRYSTAL FORM | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h64 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.68 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 5-fluoro-3-[(methoxycarbonylamino)methyl]-1-(naphthalen-1-ylmethyl)indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h66 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.13 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 3-hydroxy-4-methyl-2-[naphthalen-2-yl(phenyl)methyl]-4-phenylcyclobut-2-en-1-one | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h69 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.67 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 1-[(7-fluoronaphthalen-1-yl)methyl]indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.68 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 3-[2-(dimethylamino)-2-oxoethyl]-5-fluoro-1-(naphthalen-1-ylmethyl)indole-2-carboxylic acid (2-carboxy indole) | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.60 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 1-(2-methoxyethyl)-3-(naphthalen-1-ylmethyl)indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.64 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 1-[(8-methylnaphthalen-1-yl)methyl]indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.94 A CRYSTAL STRUCTURE OF HUMAN CATHEPSIN G IN COMPLEX WITH 1-[(7-fluoronaphthalen-1-yl)methyl]-3-[[methoxycarbonyl(methyl)amino]methyl]indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h6i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 2.10 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 5-fluoro-3-(methanesulfonamidomethyl)-1-(naphthalen-1-ylmethyl)indole-2-carboxylic acid | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bch | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the hemoglobin receptor HbpA from Corynebacterium diphtheriae | | Authors: | Mahoney, B.J., Clubb, R.T. | | Deposition date: | 2024-04-09 | | Sequence: | >Entity 1
SEEVKNADLYWGFSGSSHHKYDHNGPKFEKAGKGAELTNIDAASAYAETFKKGVFPNNKREKSDILVFHNGEVKTETNHSSYQINWPGEVTMKLGYGDGLVIKDLNLMLKNGNMGELKATVGENSNITLFDVQEYSVSDNTITVTPKIPPCTTGTWKPWHNDLTSKLGSLKSVFFESYTCNNDDIAKKPLPLTVVLNG
|
|
| PDBID: | 8xs9 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with beta-Naphthoflavone | | Authors: | Diao, X., Shang, Q., Wu, D. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8rkz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a cysteine hydrolase from Phytophthora infestans | | Authors: | Altegoer, F., Weiland, P., Bange, G. | | Deposition date: | 2024-01-02 |
|
