| PDBID: | 9uoa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of HIV-1 Reverse Transcriptase RNase H domain complexed with a galloyl inhibitor | | Authors: | Wei, S., Fujimoto, K., Tang, K., Zhan, P., Menendez-Arias, L., Hoshino, T. | | Deposition date: | 2025-04-25 |
|
| PDBID: | 9o7m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM Structure of YfdQ Reveals a Widespread Novel Family of Bacteriophage-Associated Proteins with Shell-Like Assemblies | | Authors: | Guzzo, C.R., Araujo, G.G., Merighi, D.G.S. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9ug2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Severed and capped actin fragment by two G1G3 domains of gelsolin | | Authors: | Kim, H., Jung, H.S. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9o6a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of EcKatG S-Trp105 at 2.22 Angstrom resolution revealing an asymmetric sulfur center in O=S-Trp | | Authors: | Duan, R., Li, J., Liu, A., Nathan, B., Yang, X. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9qtf | | Status: | HPUB -- hold until publication | | Title: | Simkania negevensis CE-clan virulence factor SnCE1 C256A catalytically inactive mutant | | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Simkania negevensis CE-clan virulence factor SnCE1 in complex with hsSUMO1 | | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qte | | Status: | HPUB -- hold until publication | | Title: | Simkania negevensis CE-clan virulence factor SnCE1 wildtype | | Authors: | Schmoeker, O., Girbardt, B., Palm, G.J., Hoppen, J., Schulze, S., Lammers, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtb | | Status: | HPUB -- hold until publication | | Title: | Apo form of the L-protein from Rift Valley Fever Virus (LPapo) | | Authors: | Kral, M., Das, A.R., Kotacka, T., Blahosova, A., Hodek, J., Konvalinka, J., Demo, G., Kozisek, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qlr | | Status: | HPUB -- hold until publication | | Title: | Nonamer crystal structure of the transcription factor MraZ from Mycoplasma genitalium | | Authors: | Reverter, D., Sanchez-Alba, L. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nuc | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM analysis of Phosphoglucose isomerase from P. aeruginosa reveals potential clinically relevant features | | Authors: | Sharma, K., Borgnia, J.M. | | Deposition date: | 2025-03-19 | | Release date: | 2026-03-19 |
|
| PDBID: | 9npo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CRYSTAL STRUCTURE OF MBP-TREM2 IG DOMAIN FUSION WITH ABETA 1-8 peptide | | Authors: | Brett, T.J., Greven, J.A. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9nol | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MBP-TREM2 N79Q Ig domain fusion | | Authors: | Brett, T.J., Greven, J.A. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9njh | | Status: | HPUB -- hold until publication | | Title: | Translocated product complex of DNA polymerase iota with DNA (template A) | | Authors: | Frevert, Z., Freudenthal, B., Washington, M.T. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9ibi | | Status: | HPUB -- hold until publication | | Title: | Solution NMR study of the titin I-band IgI domain I82 reveals conformational dynamics | | Authors: | Pfuhl, M., Gage, M. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIDPFTIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAELRIEKGELRSGC
|
|
| PDBID: | 9ibk | | Status: | HPUB -- hold until publication | | Title: | Solution NMR study of the titin I-band IgI domain I82 reveals conformational dynamics | | Authors: | Pfuhl, M., Gage, M. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIDPFTIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAELRIEKGELRSGC
|
|
| PDBID: | 9n92 | | Status: | HPUB -- hold until publication | | Title: | High-resolution analysis of the human T-cell leukemia virus capsid protein reveals insights into immature particle morphology | | Authors: | Arndt, W.G., Ramezani, A., Talledge, N., Yu, G., Yang, H., Chen, B., Zhang, W., Mansky, L.M., Perilla, J.R. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9mxq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 Homodimer | | Authors: | Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Anderson, K.S. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 Homodimer in Complex with 5-{2-[2-(2-oxo-4-sulfanylidene-3,4-dihydropyrimidin-1(2H)-yl)ethoxy] phenoxy}naphthalene-2-carbonitrile (JLJ648), a Non-nucleoside Inhibitor | | Authors: | Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Jorgensen, W.L., Anderson, K.S. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxs | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 Homodimer in Complex with 5-{2-[2-(2-oxo-4-sulfanylidene-3,4-dihydropyrimidin-1(2H)-yl)ethoxy] phenoxy}naphthalene-2-carbonitrile, a Non-nucleoside Inhibitor, with an Additional Pocket of Density | | Authors: | Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Jorgensen, W.L., Anderson, K.S. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 tetramer in Complex with 5-{2-[2-(2-oxo-4-sulfanylidene-3,4-dihydropyrimidin-1(2H)-yl)ethoxy]phenoxy}naphthalene-2-carbonitrile (JLJ648), a Non-nucleoside Inhibitor | | Authors: | Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Jorgensen, W.L., Anderson, K.S. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mtd | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | [1T7-12] 3D DNA Double Crossover Motif with an Even Number of Half Turns between Junctions | | Authors: | Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-01-11 |
|
| PDBID: | 9l8s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of African swine fever virus DNA polymerase (apo state 1) | | Authors: | Hu, Z., Hu, Z. | | Deposition date: | 2024-12-28 | | Release date: | 2025-12-28 |
|
| PDBID: | 9l8j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a putative phosphate binding protein from Synechocystis sp. PCC 6803 reveals an evolutionary hotspot | | Authors: | Wang, C.Y., Ma, H.L., Lu, Y.P. | | Deposition date: | 2024-12-27 |
|
| PDBID: | 9l63 | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l64 | | Status: | HPUB -- hold until publication | | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | | Authors: | Jiang, J., Fang, P. | | Deposition date: | 2024-12-24 |
|
