| PDBID: | 9yr5 | | Status: | PROC -- to be processed | | Title: | BG505.DS.SOSIP.T332N wild-type HIV-1 Envelope bound to 2 VRC16 human IgG1 fab regions | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yr8 | | Status: | PROC -- to be processed | | Title: | BG505.DS.SOSIP.T332N wild-type HIV-1 Envelope bound to 1 VRC16 human IgG1 fab region | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9szx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with 3C9 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9szm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with 3C10 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9ypf | | Status: | PROC -- to be processed | | Title: | S. aureus YhaM D193A hexamer, 3 NTDs, hairpin RNA substrate | | Authors: | Mattingly, J.M., Tanquary, J.R., Dunham, C.M. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9yo0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM sub-structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with D603G and Q617K mutations and 3 RBDs in the down state | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9yod | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM sub-structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with D603G and Q617K mutations and 1 RBD in the up state | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9yoh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM sub-structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with D603G and Q617K mutations and 2 RBDs in the up state | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9yp5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with the Q617K mutation and 3 RBDs in the down state | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9yp7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with the D603G mutation | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9ypa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with the Q617K mutation and 1 RBD in the up state | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9ym9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of AGO2 primary RISC (pri-RISC) | | Authors: | Zhang, H., Adhav, V.A., Kehling, A.C., Nakanishi, K. | | Deposition date: | 2025-10-09 |
|
| PDBID: | 9yme | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of wild-type Rhinolophus sp. PRD-0038 trimeric prefusion spike protein | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-09 |
|
| PDBID: | 9ymh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM consensus structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with D603G and Q617K mutations | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-09 |
|
| PDBID: | 9swz | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of MM762(D10A)-sgRNA/DNA ternary complex | | Authors: | Ekundayo, B.E., Ni, D.C., Stahlberg, H. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9sx0 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of eMM762v1-sgRNA/DNA ternary complex | | Authors: | Ekundayo, B.E., Ni, D.C., Stahlberg, H. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9sx4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with HT1.6 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9yk3 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with complementary RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
CGACAU
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9sw1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with A4 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-04 |
|
| PDBID: | 9svw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with S2.6 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9x0j | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | IL-33 and Etokimab fab and Tozorakimab fab ternary complex structure | | Authors: | Wang, X.Q., Wang, Y. | | Deposition date: | 2025-09-30 |
|
| PDBID: | 9sv4 | | Status: | HPUB -- hold until publication | | Title: | The ternary complex of human sirt6, ADPr and small molecule activator. | | Authors: | Moche, M., Andersson, O., Nyman, T., Strandback, E., Ampah-Korsah, H., Colquhoun, D., Spahr, H. | | Deposition date: | 2025-09-30 |
|
| PDBID: | 9x05 | | Status: | HPUB -- hold until publication | | Title: | IL-33 and Itepekimab fab and Tozorakimab fab ternary complex structure | | Authors: | Wang, X.Q., Wang, Y. | | Deposition date: | 2025-09-29 |
|
| PDBID: | 9yfz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | KrkA D193C ternary complex | | Authors: | Govind, M., Kimber, M.S. | | Deposition date: | 2025-09-27 |
|
| PDBID: | 9wxx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Free Ana-Thanatin in Free Solution | | Authors: | Abdullah, S.J., Bhattacharyya, S. | | Deposition date: | 2025-09-26 |
|
