| PDBID: | 9k4i | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of the human TRPC1/C5 heteromer | | Authors: | Chen, Y.X., Cheng, X.Y., Zhang, J. | | Deposition date: | 2024-10-21 | | Release date: | 2025-10-21 |
|
| PDBID: | 9k0b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Pictet-Spenglerases KslB in complex with L-Trp | | Authors: | Mori, T., Renata, H., Abe, I. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9gl6 | | Status: | HOLD -- hold until a certain date | | Title: | TRPC5 in complex with spin-labelled ligand SpinPico3 | | Authors: | Porav, S.A., Bon, R.S., Hammond, K.L.R. | | Deposition date: | 2024-08-27 | | Release date: | 2025-08-27 |
|
| PDBID: | 9j84 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structureal mechanism of human TRPM3 ion channel inhibition | | Authors: | Yang, T.T., Cheng, X.Y. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9j86 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis of human TRPM3 ion channels | | Authors: | Yang, T.T., Cheng, X.Y. | | Deposition date: | 2024-08-20 |
|
| PDBID: | 9isg | | Status: | HPUB -- hold until publication | | Title: | Structure of rat TRPV1 in complex with PSFL426-S5 | | Authors: | Chen, X., Yu, Y. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 9g50 | | Status: | HOLD -- hold until a certain date | | Title: | TRPC5 in complex with photoswitch Z-AzHC | | Authors: | Porav, S.A., Bon, R., Muench, S. | | Deposition date: | 2024-07-16 | | Release date: | 2025-07-16 |
|
| PDBID: | 9g4y | | Status: | HOLD -- hold until a certain date | | Title: | TRPC5 in complex with photoswitch E-AzHC | | Authors: | Porav, S.A., Bon, R., Muench, S. | | Deposition date: | 2024-07-16 | | Release date: | 2025-07-16 |
|
| PDBID: | 9g4z | | Status: | HOLD -- hold until a certain date | | Title: | TRPC5 in complex with photoswitch E-AzHC | | Authors: | Porav, S.A., Bon, R., Muench, S. | | Deposition date: | 2024-07-16 | | Release date: | 2025-07-16 |
|
| PDBID: | 9clc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan | | Authors: | Habel, E., Frkic, R.L., Jackson, C.J., Huber, T., Otting, G. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9blv | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Proteus vulgaris tryptophan indole-lyase complexed with L-Trp and benzimidazole | | Authors: | Phillips, R.S. | | Deposition date: | 2024-05-01 |
|
| PDBID: | 9be7 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9be8 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 9bds | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-12 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 8yza | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Guanine | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-06 |
|
| PDBID: | 8yyp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Adenine | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8yy7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Hypoxanthine | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yq2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | ratTRPV1 bount with inhibitor AMG9810 | | Authors: | Gao, Y.H., Li, Z.X. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b1p | | Status: | HPUB -- hold until publication | | Title: | Mycolicibacterium smegmatis ClpS with TrpSer dipeptide and Mg2+ | | Authors: | Presloid, C.J., Jiang, J., Beardslee, P.C., Anderson, H.R., Swayne, T.M., Schmitz, K.R. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 8yh7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | ratTRPV1bount with inhibitor AMG517 | | Authors: | Gao, Y.H., Li, Z.X. | | Deposition date: | 2024-02-27 |
|
| PDBID: | 8ygi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structureal mechanism of human TRPM3 ion channel inhibition by ononetin | | Authors: | Yang, T.T., Cheng, X.Y. | | Deposition date: | 2024-02-26 |
|
| PDBID: | 9asf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*03:01 in complex with a wild-type PIK3CA peptide analogue (Trp-6 Bta) | | Authors: | Ma, J., Baker, B.M. | | Deposition date: | 2024-02-25 |
|
| PDBID: | 9asg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide analogue (Trp-6 Bta) | | Authors: | Ma, J., Baker, B.M. | | Deposition date: | 2024-02-25 |
|
| PDBID: | 8ycp | | Status: | HPUB -- hold until publication | | Title: | structure of human trpv1 in complex with BC5 | | Authors: | Ke, B.W., Hu, S.L. | | Deposition date: | 2024-02-18 |
|
| PDBID: | 8r21 | | Status: | HPUB -- hold until publication | | Title: | Alpha-1-antitrypsin (Ile340Trp) in the native conformation | | Authors: | Aldobiyan, I., Lee, H.J., Lomas, D.A., Irving, J.A. | | Deposition date: | 2023-11-02 | | Sequence: | >Entity 1
MRGSHHHHHHTDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTWDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
|
|
