Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9el2
Status:HPUB -- hold until publication
Title:Human Hsp27 alpha-crystallin domain (84-171) T151I in complex with a peptide mimic of its C-terminus
Authors:Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A.
Deposition date:2024-12-03
PDBID:9el3
Status:HPUB -- hold until publication
Title:Human Hsp27 alpha-crystallin domain (84-171) T164A in complex with a peptide mimic of its C-terminus
Authors:Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A.
Deposition date:2024-12-03
PDBID:9ekp
Status:HPUB -- hold until publication
Title:Crystal structure of WDR55 in complex with XS381774
Authors:Chen, U.H., Li, F., Zeng, H., Ahmad, H., Wang, X., Sun, J., Dong, A., Seitova, A., Arrowsmith, C.H., Edwards, A.M., Peng, H., Halabelian, L., Structural Genomics Consortium (SGC)
Deposition date:2024-12-03
Sequence:

>Entity 1


SMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQEGETKELWSSGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDD
PDBID:9hk6
Status:HPUB -- hold until publication
Title:Crystal structure of IMPDH from Burkholderia thailandensis
Authors:Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H.
Deposition date:2024-12-03
PDBID:9hk7
Status:HPUB -- hold until publication
Title:Crystal structure of IMPDH from Burkholderia thailandensis
Authors:Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H.
Deposition date:2024-12-03
PDBID:9hk9
Status:HPUB -- hold until publication
Title:Crystal structure of IMPDH from Burkholderia thailandensis
Authors:Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H.
Deposition date:2024-12-03
PDBID:9hka
Status:HPUB -- hold until publication
Title:Crystal structure of IMPDH from Burkholderia thailandensis
Authors:Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H.
Deposition date:2024-12-03
PDBID:9hkb
Status:HPUB -- hold until publication
Title:Crystal structure of IMPDH from Burkholderia thailandensis
Authors:Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H.
Deposition date:2024-12-03
PDBID:9hkc
Status:HPUB -- hold until publication
Title:Crystal structure of IMPDH from Burkholderia thailandensis
Authors:Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H.
Deposition date:2024-12-03
PDBID:9hk8
Status:HPUB -- hold until publication
Title:Crystal structure of IMPDH from Burkholderia thailandensis
Authors:Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H.
Deposition date:2024-12-03
PDBID:9ek9
Status:HPUB -- hold until publication
Title:CryoEM structure of the mutant (R140Q) IDH2 homodimer
Authors:Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M.
Deposition date:2024-12-02
PDBID:9eki
Status:HPUB -- hold until publication
Title:Crystal structure of the Michaelis complex of the mutant (R140Q) IDH2 homodimer
Authors:Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M.
Deposition date:2024-12-02
Release date:2026-06-01
PDBID:9ekj
Status:HPUB -- hold until publication
Title:Crystal structure of the mutant (R140Q) IDH2 homodimer in complex with clonixin
Authors:Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M.
Deposition date:2024-12-02
Release date:2026-06-01
PDBID:9ekl
Status:HPUB -- hold until publication
Title:Crystal structure of the Michaelis complex of the mutant (R140Q, I319M) IDH2 homodimer
Authors:Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M.
Deposition date:2024-12-02
Release date:2026-06-01
PDBID:9ejw
Status:HPUB -- hold until publication
Title:MCMV immunoevasin m11 binding murine CD44
Authors:Deuss, F.A., Rossjohn, J., Sng, X.Y.X., Voigt, V., Schuster, I.S., Fleming, P., Abuwarwar, M., van Dommelen, S., Neate, G., Horsnell, H.L., Golzarroshan, B., Varelias, A., Hill, G.R., Lyman, S.D., Mueller, S.N., Scalzo, A.A., Wikstrom, M.E., Berry, R., Fletcher, A.L., Andoniou, C.E., Degli-Esposti, M.A.
Deposition date:2024-11-29
PDBID:9hjm
Status:HPUB -- hold until publication
Title:Porphyromonas gingivalis BAM complex
Authors:Madej, M., Silale, A., van den Berg, B.
Deposition date:2024-11-29
PDBID:9ej9
Status:HPUB -- hold until publication
Title:Human FANCJ helicase bound to a parallel G4 DNA
Authors:You, Q., Li, H.
Deposition date:2024-11-27
Release date:2026-05-26
PDBID:9eja
Status:HPUB -- hold until publication
Title:Human FANCJ helicase bound to a fork DNA in the closed state
Authors:You, Q., Li, H.
Deposition date:2024-11-27
Release date:2026-05-26
PDBID:9ejb
Status:HPUB -- hold until publication
Title:Human FANCJ helicase bound to a fork DNA in the open state
Authors:You, Q., Li, H.
Deposition date:2024-11-27
Release date:2026-05-26
PDBID:9ej7
Status:AUTH -- processed, waiting for author review and approval
Title:CryoEM structure of the mutant (R140Q and I319M) IDH2 homodimer
Authors:Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M.
Deposition date:2024-11-27
Release date:2026-06-01
PDBID:9hio
Status:HPUB -- hold until publication
Title:RKEC1 DNA aptamer bound to dopamine
Authors:Largy, E., Kaiyum, Y.A., Chao, E.H.P., Vialet, B., Johnson, P.E., Mackereth, C.D.
Deposition date:2024-11-26
Sequence:

>Entity 1


(DT)(DT)(DG)(DA)(DA)(DG)(DG)(DT)(DT)(DC)(DG)(DT)(DT)(DC)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DT)(DG)(DG)(DA)(DG)(DT)
PDBID:9hig
Status:HPUB -- hold until publication
Title:Cryo-EM composite structure of 70S ribosome of marine cold bacterium Pseudoalteromonas translucida (P. haloplanktis)TAC125.
Authors:Singh, V., Emmerich, A.G., Majumdar, S., Sanyal, S.
Deposition date:2024-11-26
PDBID:9hia
Status:HPUB -- hold until publication
Title:K115 acetylated human muscle pyruvate kinase, isoform M2 (PKM2), in complex with FBP
Authors:Pavlenko, D., Nudelman, H., Shahar, A., Arbely, E.
Deposition date:2024-11-25
PDBID:9hib
Status:HPUB -- hold until publication
Title:K115 acetylated human muscle pyruvate kinase, isoform M2 (PKM2)
Authors:Pavlenko, D., Nudelman, H., Shahar, A., Arbely, E.
Deposition date:2024-11-25
PDBID:9hic
Status:HPUB -- hold until publication
Title:K166 acetylated human muscle pyruvate kinase, isoform M2 (PKM2), in complex with FBP
Authors:Pavlenko, D., Nudelman, H., Shahar, A., Arbely, E.
Deposition date:2024-11-25

243911

PDB entries from 2025-10-29

PDB statisticsPDBj update infoContact PDBjnumon