| PDBID: | 9gf2 | | Status: | HPUB -- hold until publication | | Title: | This peptide is a variant of the de novo hexameric peptide, CC-Hex2, which consists of 4 heptad repeats. This peptide has been denoted CC-Hex2 as its second heptad repeat has been replaced with a hendecad repeat. | | Authors: | Kurgan, K.W., Martin, F.J.O., Woolfson, D.N. | | Deposition date: | 2024-08-08 |
|
| PDBID: | 9gf4 | | Status: | HPUB -- hold until publication | | Title: | This peptide is a variant of the previously designed de novo heptameric coiled-coil, CC-Hept-IV, which consists of 4 heptad repeats. We have denoted this de novo peptide CC-Hept-IV-hen2 as it includes a noncanonical, hendecad repeat which replaces the second heptad repeat in the original CC-Hept-IV sequence. | | Authors: | Kurgan, K.W., Martin, F.J.O., Woolfson, D.N. | | Deposition date: | 2024-08-08 |
|
| PDBID: | 9j3i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human TOM complex with Tom20 in cross-linking | | Authors: | Liu, D.S., Sui, S.F. | | Deposition date: | 2024-08-08 |
|
| PDBID: | 9d0g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with O-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution | | Authors: | Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S. | | Deposition date: | 2024-08-07 |
|
| PDBID: | 9d0h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with C-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution | | Authors: | Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S. | | Deposition date: | 2024-08-07 |
|
| PDBID: | 9d0i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Se-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.45A resolution | | Authors: | Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S. | | Deposition date: | 2024-08-07 |
|
| PDBID: | 9d0j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with BT-33, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution | | Authors: | Aleksandrova, E.V., Tresco, B.I.C., Wu, K.J.Y., Ramkissoon, A., Purdy, M., See, D.N.Y., Liu, R.Y., Myers, A.G., Polikanov, Y.S. | | Deposition date: | 2024-08-07 |
|
| PDBID: | 9d0u | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of CDK2 in complex with Cpd 2 | | Authors: | Kwiatkowski, N., Liang, T., Sha, Z., Collier, P.N., Yang, A., Sathappa, M., Paul, A., Su, L., Zheng, X., Aversa, R., Li, K., Mehovic, R., Breitkopf, S.B., Chen, D., Howarth, C.L., Yuan, K., Jo, H., Growney, J.D., Weiss, M., Williams, J. | | Deposition date: | 2024-08-07 | | Release date: | 2025-08-07 |
|
| PDBID: | 9d0v | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of CDK2/CyclinE1 in complex with Cpd 2 | | Authors: | Kwiatkowski, N., Liang, T., Sha, Z., Collier, P.N., Yang, A., Sathappa, M., Paul, A., Su, L., Zheng, X., Aversa, R., Li, K., Mehovic, R., Breitkopf, S.B., Chen, D., Howarth, C.L., Yuan, K., Jo, H., Growney, J.D., Weiss, M., Williams, J. | | Deposition date: | 2024-08-07 | | Release date: | 2025-08-07 |
|
| PDBID: | 9d0w | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of CDK2/CyclinE1 in complex with CRBN/DDB1 and Cpd 4 | | Authors: | Kwiatkowski, N., Liang, T., Sha, Z., Collier, P.N., Yang, A., Sathappa, M., Paul, A., Su, L., Zheng, X., Aversa, R., Li, K., Mehovic, R., Breitkopf, S.B., Chen, D., Howarth, C.L., Yuan, K., Jo, H., Growney, J.D., Weiss, M., Williams, J. | | Deposition date: | 2024-08-07 | | Release date: | 2025-08-07 |
|
| PDBID: | 9d0x | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of CDK2/CyclinE1 in complex with CRBN/DDB1 and Cpd 4 (local mask) | | Authors: | Kwiatkowski, N., Liang, T., Sha, Z., Collier, P.N., Yang, A., Sathappa, M., Paul, A., Su, L., Zheng, X., Aversa, R., Li, K., Mehovic, R., Breitkopf, S.B., Chen, D., Howarth, C.L., Yuan, K., Jo, H., Growney, J.D., Weiss, M., Williams, J. | | Deposition date: | 2024-08-07 | | Release date: | 2025-08-07 |
|
| PDBID: | 9gdv | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | | Authors: | Hargreaves, D. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9j24 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis of the bifunctionality of M. salinexigens ZYF650T glucosylglycerol phosphorylase in glucosylglycerol catabolism | | Authors: | Lu, D., Ma, H.L. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9j25 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis of the bifunctionality of M. salinexigens ZYF650T glucosylglycerol phosphorylase in glucosylglycerol catabolism | | Authors: | Lu, D., Ma, H.L. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9gdg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TRIM24 PHD-BRD in complex with N-(2-(2-(2-acetamidoethoxy)ethoxy)ethyl)-3-(N-(1,3-dimethyl-2-oxo-6-(3-propoxyphenoxy)-2,3-dihydro-1H-benzo[d]imidazol-5-yl)sulfamoyl)benzamide (PEG linker unresolved) | | Authors: | Platt, M.A., Kot, E., Conway, S.J., Koekemoer, L. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdi | | Status: | HPUB -- hold until publication | | Title: | HUMAN PI3KDELTA IN COMPLEX WITH ISOCUMARIN INHIBITOR 10 | | Authors: | Pala, D., Bruno, P., Capelli, A.M., Biagetti, M. | | Deposition date: | 2024-08-05 | | Sequence: | >Entity 1
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
>Entity 2
YQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
|
|
| PDBID: | 9j1u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis of the bifunctionality of M. salinexigens ZYF650T glucosylglycerol phosphorylase in glucosylglycerol catabolism | | Authors: | Lu, D., Ma, H.L. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9cze | | Status: | HPUB -- hold until publication | | Title: | High-Resolution Structure of Human DHODH for Molecular Replacement in Fragment Screening Campaign | | Authors: | Purificacao, A.D., Benz, L.S., Froes, T.Q., Weiss, M.S., Nonato, M.C. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gcq | | Status: | HPUB -- hold until publication | | Title: | Human Butyrylcholinesterase in complex with N1,N1-dimethyl-N2-(6-(naphthalen-2-yl)-5-(pyridin-4-yl)pyridazin-3-yl)ethane-1,2-diamine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcr | | Status: | HPUB -- hold until publication | | Title: | Human Butyrylcholinesterase in complex with N1,N1-dimethyl-N2-(6-(naphthalen-1-yl)-5-(pyridin-4-yl)pyridazin-3-yl)ethane-1,2-diamine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9j0e | | Status: | HPUB -- hold until publication | | Title: | Catalyst-free photoinitiated intramolecular carbon-carbon coupling enables the efficient synthesis of pharmaceutically important biaryls | | Authors: | Yang, L., Qu, X.D. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gc2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI- a603-NH mutant | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc4 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | | Authors: | Hargreaves, D. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc6 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | | Authors: | Hargreaves, D. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pseudomonas aeruginosa IspD in complex with C11H12N2O3 | | Authors: | Borel, F., D''Auria, L. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPHLE
|
|
