| PDBID: | 9gcn | | Status: | HPUB -- hold until publication | | Title: | Co-crystal VHH (TPL1158_01_C09) - alpha-cobratoxin (Naja kaouthia) | | Authors: | Rivera-de-Torre, E., Burlet, N.J., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcq | | Status: | HPUB -- hold until publication | | Title: | Human Butyrylcholinesterase in complex with N1,N1-dimethyl-N2-(6-(naphthalen-2-yl)-5-(pyridin-4-yl)pyridazin-3-yl)ethane-1,2-diamine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cy9 | | Status: | HOLD -- hold until a certain date | | Title: | Biofilm regulatory protein A from Streptococcus mutans | | Authors: | Hua, Z., Hui, W. | | Deposition date: | 2024-08-01 | | Release date: | 2025-08-01 |
|
| PDBID: | 9cy5 | | Status: | HPUB -- hold until publication | | Title: | Dyrk1a bound to a competitive inhibitor | | Authors: | Montfort, W.R. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gcb | | Status: | HPUB -- hold until publication | | Title: | Structure of IsDUF4198 | | Authors: | Franco Cairo, J.P.L., Correa, T.L.R., Offen, W.A., Nairn, A., Walton, J., Davies, G.J., Walton, P.H. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI- a603-NH mutant | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cxt | | Status: | HPUB -- hold until publication | | Title: | Hemagglutinin A/Hong Kong/1/68 produced in GnTI- cells | | Authors: | Torrents de la Pena, A., de Paiva Froes Rocha, R., Ward, A.B. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxu | | Status: | HPUB -- hold until publication | | Title: | Endo H-treated hemagglutinin A/Hong Kong/1/68 | | Authors: | Torrents de la Pena, A., de Paiva Froes Rocha, R., Ward, A.B. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9gbi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI wild-type | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cx1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*03:01 L156Q mutant in complex with a mutant PIK3CA peptide | | Authors: | Ma, J., Baker, B.M. | | Deposition date: | 2024-07-30 | | Release date: | 2026-01-29 |
|
| PDBID: | 9cx2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*03:01 L156Q mutant in complex with a mutant PIK3CA peptide | | Authors: | Ma, J., Baker, B.M. | | Deposition date: | 2024-07-30 | | Release date: | 2026-01-29 |
|
| PDBID: | 9cwy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*03:02 in complex with a wild-type PIK3CA peptide | | Authors: | Ma, J., Baker, B.M. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9cwz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*03:02 in complex with a mutant PIK3CA peptide | | Authors: | Perera, W.W.J.G., Ma, J., Baker, B.M. | | Deposition date: | 2024-07-30 | | Release date: | 2026-01-29 |
|
| PDBID: | 9cx0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*03:01 E152V mutant in complex with a mutant PIK3CA peptide | | Authors: | Ma, J., Lazar, J.A., Baker, B.M. | | Deposition date: | 2024-07-30 | | Release date: | 2026-01-29 |
|
| PDBID: | 9cwo | | Status: | HPUB -- hold until publication | | Title: | Cryo EM structure of Nipah virus L-P polymerase complex | | Authors: | Deniston, C., Buffalo, C., Rohaim, A. | | Deposition date: | 2024-07-29 |
|
| PDBID: | 9ix9 | | Status: | HPUB -- hold until publication | | Title: | Mutant H286T Crystal Structure of Two-domain bacterial laccase from the actinobacterium Streptomyces carpinensis VKM Ac-1300 | | Authors: | Gabdulkhakov, A.G., Tishchenko, T.V., Trubitsina, L., Trubitsin, I., Leontievsky, A., Lisov, A. | | Deposition date: | 2024-07-26 |
|
| PDBID: | 9ga9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure hASF1A 156-cr7 | | Authors: | Ochsenbein, F.O., Vitard, A.V. | | Deposition date: | 2024-07-26 | | Release date: | 2026-01-26 |
|
| PDBID: | 9iwb | | Status: | HPUB -- hold until publication | | Title: | High Resolution Crystal Structure of Glyceraldehyde-3-Phosphate Dehydrogenase from Saccharomyces cerevisiae Complexed with a Maleate Derivative | | Authors: | Cao, H., Zhang, X., Ren, Y., Wan, J. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwc | | Status: | HPUB -- hold until publication | | Title: | High Resolution Crystal Structure of Glyceraldehyde-3-Phosphate Dehydrogenase from Saccharomyces cerevisiae Complexed with a Maleate Derivative | | Authors: | Cao, H., Zhang, X., Ren, Y., Wan, J. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9iwd | | Status: | HPUB -- hold until publication | | Title: | High Resolution Crystal Structure of Glyceraldehyde-3-Phosphate Dehydrogenase from Saccharomyces cerevisiae Complexed with a Maleate Derivative | | Authors: | Cao, H., Zhang, X., Ren, Y., Wan, J. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9cu7 | | Status: | HPUB -- hold until publication | | Title: | Structure of 16.ND.92 Fab in complex with A/Solomon Islands/3/2006(H1N1) influenza virus Hemagglutinin | | Authors: | Ouyang, W.O., Pholcharee, T., Wu, N.C. | | Deposition date: | 2024-07-25 |
|
| PDBID: | 9g9u | | Status: | HOLD -- hold until a certain date | | Title: | The structure of XynX, a NIF3 family protein from Geobacillus proteiniphilus T-6 | | Authors: | Hadad, N., Pomyalov, S., Lavid, N., Shoham, Y., Shoham, G. | | Deposition date: | 2024-07-25 | | Release date: | 2025-07-25 |
|
| PDBID: | 9csx | | Status: | HPUB -- hold until publication | | Title: | matrix metalloproteinase-10 proenzyme | | Authors: | Isiorho, E.A. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9csj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human glyoxalase domain-containing protein 4 (GLOD4) at 2.33 A resolution. | | Authors: | Griswold-Prenner, I., Dou, Y., Jennings, A., Kayser, F. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9g8t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the persulfide dioxygenase (PDO - PA2915) from Pseudomonas aeruginosa | | Authors: | Troilo, F., Giordano, F., Giuffre, A., Giardina, G., Di Matteo, A. | | Deposition date: | 2024-07-24 | | Sequence: | >Entity 1
MLKPDITAFFDPATSTYSYVVRDPSSRACAIVDPVLDYDPAAGRTSHASAERLIAHVRQHDLQVEWLLETHVHADHLSAAIFLQRELGGCLAIGARITQVQAKFSGLFNLGEAFPVDGRQFEHLFEDGESFRIGALECRALHTPGHTPACMTYLVGDSAFVGDTLFMPDYGTARCDFPGGDARQLYRSIQRLFALPDATRLFMCHDYTAPGRDEHRCETSVGEQRRHNVHVREGVDEEAFVAMRQQRDATLGMPTLMLPAIQVNMRGGNLPPVEGNGVRYLKIPLDLFLEHHHHHH
|
|
