Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9yj1
Status:AUTH -- processed, waiting for author review and approval
Title:PC94-A.31 Fab in complex with BG505 SOSIP trimer and RM20A3 Fab
Authors:Phulera, S., Omorodion, O., Ward, A.B., Ozorowski, G.
Deposition date:2025-10-03
PDBID:9yjl
Status:HPUB -- hold until publication
Title:Joint X-ray/neutron structure of wild-type Bacillus halodurans RNase H1 in the apo-form
Authors:Kovalevsky, A., Gerlits, O.
Deposition date:2025-10-03
Sequence:

>Entity 1


SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
PDBID:9yjm
Status:HPUB -- hold until publication
Title:Joint X-ray/neutron structure of D132N Bacillus halodurans RNase H1 in the apo-form
Authors:Kovalevsky, A., Gerlits, O.
Deposition date:2025-10-03
Sequence:

>Entity 1


SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
PDBID:9yjq
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of anti-HCV human neutralizing antibody K601
Authors:Nguyen, T.K.Y., Wilson, I.A.
Deposition date:2025-10-03
PDBID:9yjs
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of anti-HCV human neutralizing antibody K400
Authors:Nguyen, T.K.Y., Wilson, I.A.
Deposition date:2025-10-03
PDBID:9svi
Status:HPUB -- hold until publication
Title:Cryo-EM structure of CRBN bound to 1-[1-(4-piperidyl)indol-4-yl]hexahydropyrimidine-2,4-dione in the open conformation
Authors:Cowan, A.D., Rutter, Z.J., McAulay, K., Ciulli, A.
Deposition date:2025-10-03
PDBID:9svu
Status:AUTH -- processed, waiting for author review and approval
Title:ORF904 tetramer bound to dsDNA
Authors:Clery, A., Rabl, J., Schneider, A., Wu, P., Lipps, G., Allain, F.H.T.
Deposition date:2025-10-03
PDBID:9svl
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of human carbonic anhydrase II in complex with 4-ethoxy-3-(1-methyl-7-oxo-3-propyl-6,7-dihydro-1H-pyrazolo[4,3-d]pyrimidin-5-yl)benzenesulfonamide
Authors:Angeli, A., Ferraroni, M.
Deposition date:2025-10-03
PDBID:9svw
Status:AUTH -- processed, waiting for author review and approval
Title:Human fumarylacetoacetate hydrolase (FAH) in complex with S2.6
Authors:Scarin, R., Rojas, A.L., Millet, O.
Deposition date:2025-10-03
PDBID:9yip
Status:PROC -- to be processed
Title:Crystal structure of human IL-8 in a large unit cell
Authors:Lodowski, D.T., Chapman, P.Q.
Deposition date:2025-10-02
PDBID:9yiy
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of mouse coatomer beta2-WD40 domain in complex with MHV spike tail hepta-peptide
Authors:Dey, D., Shakya, A.K., Hasan, S.S.
Deposition date:2025-10-02
PDBID:9yiv
Status:PROC -- to be processed
Title:HLA-F single chain dimer with an empty binding groove
Authors:Finton, K.A.K., Avery, N., Rupert, P.B.
Deposition date:2025-10-02
PDBID:9yiu
Status:AUTH -- processed, waiting for author review and approval
Title:Macrophage Migration Inhibitory Factor 2 from Necator americanus
Authors:Orkwis, J.A., Lolis, E.J., Ramu, M.
Deposition date:2025-10-02
PDBID:9yiw
Status:AUTH -- processed, waiting for author review and approval
Title:PC94-A.15 Fab in complex with BG505 SOSIP trimer and RM20A3 Fab
Authors:Phulera, S., Omorodion, O., Ward, A.B., Ozorowski, G.
Deposition date:2025-10-02
PDBID:9sv8
Status:AUTH -- processed, waiting for author review and approval
Title:Herpes simplex virus 2 delta28-73 glycoprotein C ectodomain in complex with C3b
Authors:Rojas Rechy, M.H., Atanasiu, D., Hook, L.M., Cairns, M.T., Saw, W.T., Cahill, A., Guo, Z., Calabrese, A.N., Ranson, N.A., Friedman, H.M., Cohen, G.H., Fontana, J.
Deposition date:2025-10-02
PDBID:9yi5
Status:AUTH -- processed, waiting for author review and approval
Title:Macrophage Migration Inhibitory Factor 2 from Heligmosomoides polygyrus
Authors:Orkwis, J.A., Lolis, E.J.
Deposition date:2025-10-01
PDBID:9yhw
Status:AUTH -- processed, waiting for author review and approval
Title:DNA ligase 1 E346A/E592A in complex with nick containing 3''-8oxodG:A captured at pre-catalytic stage
Authors:KanalElamparithi, B., Caglayan, M.
Deposition date:2025-10-01
PDBID:9yhu
Status:AUTH -- processed, waiting for author review and approval
Title:DNA ligase 1 E346A/E592A in complex with nick containing 3''-8oxorG:A captured at post-catalytic stage
Authors:KanalElamparithi, B., Caglayan, M.
Deposition date:2025-10-01
PDBID:9yhb
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of IDH1 R132H C269S
Authors:Hu, L., Seo, H.-S., Dhe-Paganon, S., Berezuk, A.M., Tuttle, K.S., Zhu, X., Subramaniam, S., Wu, X.
Deposition date:2025-09-30
PDBID:9sut
Status:AUTH -- processed, waiting for author review and approval
Title:gamma carbonic anhydrase LreCA from Limosilactobacillus reuteri in space group I222
Authors:Angeli, A., Ferraroni, M.
Deposition date:2025-09-30
PDBID:9sv2
Status:AUTH -- processed, waiting for author review and approval
Title:Intertwined dimer of the Acylphosphatase from E. coli
Authors:Camara-Artigas, A., Martinez-Rodriguez, S., Gavira, J.A., Salinas-Garcia, M.C.
Deposition date:2025-09-30
PDBID:9sv1
Status:AUTH -- processed, waiting for author review and approval
Title:Acylphosphatase from E. coli
Authors:Camara-Artigas, A., Martinez-Rodriguez, S., Gavira, J.A., Salinas-Garcia, M.C.
Deposition date:2025-09-30
PDBID:9suz
Status:AUTH -- processed, waiting for author review and approval
Title:gamma carbonic anhydrase LreCA from Limosilactobacillus reuteri in space group P212121
Authors:Angeli, A., Ferraroni, M.
Deposition date:2025-09-30
PDBID:9wza
Status:AUTH -- processed, waiting for author review and approval
Title:A Genetically Encoded Photomagnetic Platform for Spin-Regulated Redox Signaling in Cells
Authors:Wang, J.Y., Gong, W.M., Liu, H.P., Liu, X.H., Jiang, L., Wang, M.Z., Li, Y.Z.
Deposition date:2025-09-29
Release date:2026-09-29
PDBID:9wzy
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Sturcture of BRD4 BD1 Domain Complexed with a Molecular Glue Probe
Authors:Hu, X., Cao, H., Li, W., Chang, M., Zhang, Y., Ren, Y., Wan, J.
Deposition date:2025-09-29

243911

PDB entries from 2025-10-29

PDB statisticsPDBj update infoContact PDBjnumon