| PDBID: | 9yj1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PC94-A.31 Fab in complex with BG505 SOSIP trimer and RM20A3 Fab | | Authors: | Phulera, S., Omorodion, O., Ward, A.B., Ozorowski, G. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yjl | | Status: | HPUB -- hold until publication | | Title: | Joint X-ray/neutron structure of wild-type Bacillus halodurans RNase H1 in the apo-form | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-03 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
|
|
| PDBID: | 9yjm | | Status: | HPUB -- hold until publication | | Title: | Joint X-ray/neutron structure of D132N Bacillus halodurans RNase H1 in the apo-form | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-03 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
|
|
| PDBID: | 9yjq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of anti-HCV human neutralizing antibody K601 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yjs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of anti-HCV human neutralizing antibody K400 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CRBN bound to 1-[1-(4-piperidyl)indol-4-yl]hexahydropyrimidine-2,4-dione in the open conformation | | Authors: | Cowan, A.D., Rutter, Z.J., McAulay, K., Ciulli, A. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | ORF904 tetramer bound to dsDNA | | Authors: | Clery, A., Rabl, J., Schneider, A., Wu, P., Lipps, G., Allain, F.H.T. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human carbonic anhydrase II in complex with 4-ethoxy-3-(1-methyl-7-oxo-3-propyl-6,7-dihydro-1H-pyrazolo[4,3-d]pyrimidin-5-yl)benzenesulfonamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9svw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with S2.6 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-03 |
|
| PDBID: | 9yip | | Status: | PROC -- to be processed | | Title: | Crystal structure of human IL-8 in a large unit cell | | Authors: | Lodowski, D.T., Chapman, P.Q. | | Deposition date: | 2025-10-02 |
|
| PDBID: | 9yiy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of mouse coatomer beta2-WD40 domain in complex with MHV spike tail hepta-peptide | | Authors: | Dey, D., Shakya, A.K., Hasan, S.S. | | Deposition date: | 2025-10-02 |
|
| PDBID: | 9yiv | | Status: | PROC -- to be processed | | Title: | HLA-F single chain dimer with an empty binding groove | | Authors: | Finton, K.A.K., Avery, N., Rupert, P.B. | | Deposition date: | 2025-10-02 |
|
| PDBID: | 9yiu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Macrophage Migration Inhibitory Factor 2 from Necator americanus | | Authors: | Orkwis, J.A., Lolis, E.J., Ramu, M. | | Deposition date: | 2025-10-02 |
|
| PDBID: | 9yiw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PC94-A.15 Fab in complex with BG505 SOSIP trimer and RM20A3 Fab | | Authors: | Phulera, S., Omorodion, O., Ward, A.B., Ozorowski, G. | | Deposition date: | 2025-10-02 |
|
| PDBID: | 9sv8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Herpes simplex virus 2 delta28-73 glycoprotein C ectodomain in complex with C3b | | Authors: | Rojas Rechy, M.H., Atanasiu, D., Hook, L.M., Cairns, M.T., Saw, W.T., Cahill, A., Guo, Z., Calabrese, A.N., Ranson, N.A., Friedman, H.M., Cohen, G.H., Fontana, J. | | Deposition date: | 2025-10-02 |
|
| PDBID: | 9yi5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Macrophage Migration Inhibitory Factor 2 from Heligmosomoides polygyrus | | Authors: | Orkwis, J.A., Lolis, E.J. | | Deposition date: | 2025-10-01 |
|
| PDBID: | 9yhw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DNA ligase 1 E346A/E592A in complex with nick containing 3''-8oxodG:A captured at pre-catalytic stage | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2025-10-01 |
|
| PDBID: | 9yhu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DNA ligase 1 E346A/E592A in complex with nick containing 3''-8oxorG:A captured at post-catalytic stage | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2025-10-01 |
|
| PDBID: | 9yhb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of IDH1 R132H C269S | | Authors: | Hu, L., Seo, H.-S., Dhe-Paganon, S., Berezuk, A.M., Tuttle, K.S., Zhu, X., Subramaniam, S., Wu, X. | | Deposition date: | 2025-09-30 |
|
| PDBID: | 9sut | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | gamma carbonic anhydrase LreCA from Limosilactobacillus reuteri in space group I222 | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2025-09-30 |
|
| PDBID: | 9sv2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Intertwined dimer of the Acylphosphatase from E. coli | | Authors: | Camara-Artigas, A., Martinez-Rodriguez, S., Gavira, J.A., Salinas-Garcia, M.C. | | Deposition date: | 2025-09-30 |
|
| PDBID: | 9sv1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Acylphosphatase from E. coli | | Authors: | Camara-Artigas, A., Martinez-Rodriguez, S., Gavira, J.A., Salinas-Garcia, M.C. | | Deposition date: | 2025-09-30 |
|
| PDBID: | 9suz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | gamma carbonic anhydrase LreCA from Limosilactobacillus reuteri in space group P212121 | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2025-09-30 |
|
| PDBID: | 9wza | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | A Genetically Encoded Photomagnetic Platform for Spin-Regulated Redox Signaling in Cells | | Authors: | Wang, J.Y., Gong, W.M., Liu, H.P., Liu, X.H., Jiang, L., Wang, M.Z., Li, Y.Z. | | Deposition date: | 2025-09-29 | | Release date: | 2026-09-29 |
|
| PDBID: | 9wzy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Sturcture of BRD4 BD1 Domain Complexed with a Molecular Glue Probe | | Authors: | Hu, X., Cao, H., Li, W., Chang, M., Zhang, Y., Ren, Y., Wan, J. | | Deposition date: | 2025-09-29 |
|
