PDBID: | 9h1u | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Heterooligomeric Bacterioferritin | Authors: | Stein, D., Zalk, R., Shahar, A., Zarivach, R., Frank, G.A. | Deposition date: | 2024-10-10 |
|
PDBID: | 9h1r | Status: | HPUB -- hold until publication | Title: | Arbitrium receptor | Authors: | Gallego del Sol, F., Marina, A. | Deposition date: | 2024-10-10 |
|
PDBID: | 9h22 | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of RC-dLH complex model II from Gemmatimonas groenlandica | Authors: | Gardiner, A.T., Jing, Y., Bina, D., Mujakic, I., Gardian, Z., Kaftan, D., Joosten, M., Jakobi, A., Castro-Hartmann, P., Qian, P., Koblizek, M. | Deposition date: | 2024-10-10 |
|
PDBID: | 9dx4 | Status: | AUTH -- processed, waiting for author review and approval | Title: | EcRuvB T102R mutant | Authors: | Rish, A.D., Fu, T.M. | Deposition date: | 2024-10-10 |
|
PDBID: | 9dx5 | Status: | AUTH -- processed, waiting for author review and approval | Title: | EcRuvB T102R hexamer assembly | Authors: | Rish, A.D., Fu, T.M. | Deposition date: | 2024-10-10 |
|
PDBID: | 9h1t | Status: | HPUB -- hold until publication | Title: | Crystal structure of apo-tyrosinase from Priestia megaterium F227Y mutant | Authors: | Englund, A.N.B., Rohr, A.K. | Deposition date: | 2024-10-10 |
|
PDBID: | 9h0t | Status: | HPUB -- hold until publication | Title: | N terminal domain of BC2L-C lectin (1-131) in complex with a beta-fucosylamide side-product | Authors: | Antonin, G., Varrot, A. | Deposition date: | 2024-10-09 | Sequence: | >Entity 1 GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
PDBID: | 9h0z | Status: | HPUB -- hold until publication | Title: | Crystal structure of TTL[Nle], thermophilic lipase TTL from Thermoanaerobacter thermohydrosulfuricus containing non-canonical amino acid Nle at the position of Met | Authors: | Hromic-Jahjefendic, A., Pavkov-Keller, T., Wiltschi, B., Gruber, K. | Deposition date: | 2024-10-09 |
|
PDBID: | 9jvq | Status: | AUTH -- processed, waiting for author review and approval | Title: | A protein complex | Authors: | Takeda, H., Endo, T., Kikkawa, M., Akihisa, T. | Deposition date: | 2024-10-09 | Release date: | 2025-10-09 |
|
PDBID: | 9h0u | Status: | HPUB -- hold until publication | Title: | N terminal domain of BC2L-C lectin (1-131) with covalent beta-fucosylamide ligand | Authors: | Antonini, G., Varrot, A. | Deposition date: | 2024-10-09 | Sequence: | >Entity 1 GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
PDBID: | 9h19 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of RC-dLH complex model I from Gem. groenlandica strain TET16 | Authors: | Gardiner, A., Qian, P., Koblizek, M., Jing, Y., Joosten, M., Jakobi, A., Bina, D., Mujakic, I., Gardian, Z., Kaftan, D., Castro-Hartmann, P. | Deposition date: | 2024-10-09 |
|
PDBID: | 9h0k | Status: | HPUB -- hold until publication | Title: | Crystal structure of human CREBBP histone acetyltransferase domain in complex with Propionyl- Coenzyme A | Authors: | Mechaly, A.E., Cui, G., Green, M.R., Rodrigues-Lima, F. | Deposition date: | 2024-10-08 |
|
PDBID: | 9h0h | Status: | HPUB -- hold until publication | Title: | X-RAY CRYSTAL STRUCTURE OF THE CsPYL1-OPABACTIN-HAB1 TERNARY COMPLEX | Authors: | Rivera-Moreno, M., Infantes, L., Albert, A. | Deposition date: | 2024-10-08 |
|
PDBID: | 9h0i | Status: | HPUB -- hold until publication | Title: | X-RAY CRYSTAL STRUCTURE OF THE CsPYL1-iCB-HAB1 TERNARY COMPLEX | Authors: | Rivera-Moreno, M., Infantes, L., Albert, A. | Deposition date: | 2024-10-08 |
|
PDBID: | 9jty | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Postload capsid of phiYY, a prokaryotic dsRNA virus | Authors: | Meng, K.W., Huyan, Y.N., Meng, G. | Deposition date: | 2024-10-08 |
|
PDBID: | 9h0j | Status: | HPUB -- hold until publication | Title: | X-RAY CRYSTAL STRUCTURE OF THE CsPYL1 5M (V112L, T135L, F137I, T153I, V168A)-iCB-HAB1 TERNARY COMPLEX | Authors: | Rivera-Moreno, M., Infantes, L., Albert, A. | Deposition date: | 2024-10-08 |
|
PDBID: | 9h02 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human CREBBP histone acetyltransferase domain in complex with a bisubstrate inhibitor, Lys-CoA | Authors: | Mechaly, A.E., Cui, G., Green, M.R., Rodrigues-Lima, F. | Deposition date: | 2024-10-07 |
|
PDBID: | 9h01 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | nsp14 of SARS-CoV-2 in complex with a camelid nanobody | Authors: | Gauffre, P., Ferron, F., Canard, B. | Deposition date: | 2024-10-07 |
|
PDBID: | 9ju3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | 3-fold Block-refine of Full particle of phiYY, a prokaryotic dsRNA virus | Authors: | Meng, K.W., Cui, C.X., HuYan, Y.N., Zhang, X.Z., Meng, G. | Deposition date: | 2024-10-07 |
|
PDBID: | 9jua | Status: | HPUB -- hold until publication | Title: | The complex of Eny2B and Sgf11 of Drosophila melanogaster | Authors: | Boyko, K.M., Bonchuk, A.N., Nikolaeva, A.Y., Arkova, O.V., Belova, E.V., Georgiev, P.G., Popov, V.O. | Deposition date: | 2024-10-07 |
|
PDBID: | 9dve | Status: | HPUB -- hold until publication | Title: | X-ray crystal structure of Kohinoor reversibly switchable fluorescent protein | Authors: | Richardson, B.C., He, Y., Iuliano, J.N., Woroniecka, H.A., French, J.B. | Deposition date: | 2024-10-07 |
|
PDBID: | 9jtf | Status: | HPUB -- hold until publication | Title: | Crystal structure of human BAF155-BRG1 fusion protein | Authors: | Hattori, N., Hamada, K., Oguni, A., Ogata, K., Ito, T. | Deposition date: | 2024-10-04 |
|
PDBID: | 9gzq | Status: | HPUB -- hold until publication | Title: | Structure of ForCE lacking the Helical Membrane Plug-in (HMP; DUF1641) | Authors: | Arnoux, P., Cherrier, M.V., Nicolet, Y., Legrand, P., Broc, M., Seduk, F., Arias-Cartin, R., Magalon, A., Walburger, A. | Deposition date: | 2024-10-04 |
|
PDBID: | 9gyf | Status: | HPUB -- hold until publication | Title: | Ku70/80 with PAXX peptide mutation K193R | Authors: | Chaplin, A.K., Malewicz, M. | Deposition date: | 2024-10-02 |
|
PDBID: | 9gyg | Status: | HPUB -- hold until publication | Title: | The structure of ornithine decarboxylase from Leishmania infantum in complex with PLP | Authors: | Fiorillo, A., Antonelli, A., Ilari, A., Tria, G. | Deposition date: | 2024-10-02 | Sequence: | >Entity 1 MGSSHHHHHHSSGLVPRGSHMGDHDVALCHVSRYNHANYWAFVPLPTVSDDTGCDSLHHDSASERIRMAPPASASKAGAAEERLHPYERRLLDQYQIHLQPANRNPLSRADSAAGREETAQTPAQVQMVSGVAVADSTSDQHASVASSQDLVDLFFLEGSQAVDGLCFSPYPIYGWRTAEERRAAVCEVFKTYNVVTRLPASPAALAAAQRRYSRHRHSAIAPINKSAIETREQYWRRLSNLYTQKGVKDAASAADAAATTATNGAVPAAPAYEPEDPFYIIDLGRVVEQMARWRHELPMVRPYFAV(LLP)SNPQPAVLEVLSALGAGFDCASKEEIHMVLGRQLVASPDDIIFANPCKQLGDLREAQACGVTYVTVDNPLEMEKISRLMPSAHAIIRIKTNDSKAQCSFSTKFGAPLEDVEGLLEAARQFNVTVCGVSFHVGSGNDDQSAYVSAVRDAYQVFQQAVQYGFKCTILDIGGGFPGTEVVEGSGNTSFEAIARTIRPVLAELFGGGDVTIISEPGRYFTAASHALLMNVFASRTLRLSDVEVSRQAFQSVVSMDEPEEYQYYVNDGLYHSFNCILFDHAHPTLLLLNDGDGADGVESGTEAAAVCSEEEGETSLSGPLANDALFMSAWDRRRSFARRPLRITTIFGPTCDSMDCILKKQPFPEMKLGDWLLVPDMGSYTTAAAGFFNGFATRRLEWVSSVDLCARPRPVYTREGNTLRCVSE
|
|