| PDBID: | 9jl0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of feline CD8aa homodimer | | Authors: | Li, Z., Liang, R. | | Deposition date: | 2024-09-17 | | Sequence: | >Entity 1
MPSPFRLSPVRVEGRLGQRVELQCEVLLSSAAPGCTWLFQKNEPAARPIFLAYLSRSRTKLAEELDPKQISGQRIQDTLYSLTLHRFRKEEEGYYFCSVVSNSVLYFSAFVPVFLPVKPTTTP
|
|
| PDBID: | 9jkx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | acifran-HCAR3-Gi complex | | Authors: | Binghao, Z., Fang, Y. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9jky | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | acifran-HCAR2-Gi complex | | Authors: | Binghao, Z., Fang, Y. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9jkz | | Status: | HPUB -- hold until publication | | Title: | CYP105A1 R84A complexed with simvastatin | | Authors: | Mikami, B., Takita, T., Sakaki, T., Yasuda, K., Yasukawa, K., Yoneda, S., Yamagata, M. | | Deposition date: | 2024-09-17 | | Sequence: | >Entity 1
MTDTATTPQTTDAPAFPSNRSCPYQLPDGYAQLRDTPGPLHRVTLYDGRQAWVVTKHEAARKLLGDPRLSSNRTDDNFPATSPAFEAVRESPQAFIGLDPPEHGTRRRMTISEFTVKRIKGMRPEVEEVVHGFLDEMLAAGPTADLVSQFALPVPSMVICRLLGVPYADHEFFQDASKRLVQSTDAQSALTARNDLAGYLDGLITQFQTEPGAGLVGALVADQLANGEIDREELISTAMLLLIAGHETTASMTSLSVITLLDHPEQYAALRADRSLVPGAVEELLRYLAIADIAGGRVATADIEVEGQLIRAGEGVIVVNSIANRDGTVYEDPDALDIHRSARHHLAFGFGVHQCLGQNLARLELEVILNALMDRVPTLRLAVPVEQLVLRPGTTIQGVNELPVTWHHHHHH
|
|
| PDBID: | 9jl1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SpCas9 with mini-gRNA conformation | | Authors: | Xi, Z. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9jl2 | | Status: | HPUB -- hold until publication | | Title: | Classical conformation for the spCas9 with gRNA and target DNA complex | | Authors: | Xi, Z. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9jl4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Apo-spCas9 conformation | | Authors: | Xi, Z. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dnd | | Status: | HPUB -- hold until publication | | Title: | Pseudosymmetric protein nanocage GI4 -F7 (local refinement) | | Authors: | Park, Y.J., Dowling, Q.M., Seattle Structural Genomics Center for Infectious Disease (SSGCID), King, N.P., Veesler, D. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dne | | Status: | HPUB -- hold until publication | | Title: | Pseudosymmetric protein nanocage GI9-F7 (local refinement) | | Authors: | Park, Y.J., Dowling, Q.M., King, N.P., Seattle Structural Genomics Center for Infectious Disease (SSGCID), Veesler, D. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dno | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dnb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dng | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dnf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dnj | | Status: | PROC -- to be processed | | Title: | Anti-HCV Fab HC84-1 mutant | | Authors: | Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dnn | | Status: | HPUB -- hold until publication | | Title: | Insulin receptor in complex with both insulin and de novo designed site-2 binder ""S2B"". | | Authors: | Bai, X.C. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dni | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Insulin receptor bound with de novo designed agonist called ""S2-F1-S1"" | | Authors: | Bai, X.C. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dn8 | | Status: | PROC -- to be processed | | Title: | RamR variant S2.3 complexed with 1S-1-phenyl-1,2,3,4-tetrahydroisoquinoline | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dn9 | | Status: | PROC -- to be processed | | Title: | RamR variant S2.4 complexed with 1S-1-phenyl-1,2,3,4-tetrahydroisoquinoline | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dnc | | Status: | PROC -- to be processed | | Title: | Apo crystal structure of RamR variant D2.1 | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dnh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | RamR variant D2.3 complexed with 1-phenyl-dihydroisoquinoline | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dnk | | Status: | PROC -- to be processed | | Title: | RamR variant R2.1 complexed with 1R-1-phenyl-1,2,3,4-tetrahydroisoquinoline. | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dnm | | Status: | HPUB -- hold until publication | | Title: | Structure of rat beta-arrestin 1 bound to allosteric inhibitor | | Authors: | Pakharukova, N., Kahsai, A.W., Masoudi, A., Lefkowitz, R.J. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dnl | | Status: | PROC -- to be processed | | Title: | Apo crystal structure of RamR variant R2.2 | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dnp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-17 |
|
| PDBID: | 9dnq | | Status: | HPUB -- hold until publication | | Title: | Structure of UBR2-RFF complex | | Authors: | Huang, S., Wu, J., Taylor, S., Chen, Y. | | Deposition date: | 2024-09-17 |
|
