PDBID: | 9h5d | Status: | HPUB -- hold until publication | Title: | Crystal structure of sheep (Ovis aries) oxyhemoglobin at 2.1 Angstrom resolution | Authors: | Farheen, P., Shobana, N., Onisuru, O., Achilonu, I.A., Mather, A., Ponnuswamy, M.N., Sayed, Y., Pandian, R. | Deposition date: | 2024-10-22 |
|
PDBID: | 9k70 | Status: | HPUB -- hold until publication | Title: | A (3+1) hybrid G-quadruplex assembled between two strands of human telomeric DNA and RNA | Authors: | Fu, W.Q., Zhang, N. | Deposition date: | 2024-10-22 |
|
PDBID: | 9e2c | Status: | HPUB -- hold until publication | Title: | Crystal structure of DEAD-box RNA helicase DDX3X R326H mutant | Authors: | Prado, P.F.V., Oliveira, J.F., Nascimento, A.F.Z. | Deposition date: | 2024-10-22 |
|
PDBID: | 9e2d | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to a di-nucleosome with a five base pair linker | Authors: | Xie, X., Liu, M., Zhou, X.E., Worden, E., Jones, P. | Deposition date: | 2024-10-22 |
|
PDBID: | 9e2f | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of a di-nucleosome with a five base pair linker | Authors: | Xie, X., Liu, M., Zhou, X.E., Worden, E., Jones, P. | Deposition date: | 2024-10-22 |
|
PDBID: | 9e2r | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to a di-nucleosome and an histone-3 peptide | Authors: | Xie, X., Liu, M., Zhou, X.E., Worden, E., Jones, P. | Deposition date: | 2024-10-22 |
|
PDBID: | 9e2q | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of DNMT 3A2/3B3 tetramer in complex with a di-nucleosome with a six base pair linker | Authors: | Xie, X., Liu, M., Zhou, X.E., Worden, E., Jones, P. | Deposition date: | 2024-10-22 |
|
PDBID: | 9e2t | Status: | HOLD -- hold until a certain date | Title: | Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg | Authors: | Abhiraman, G.C., Jude, K.M., Garcia, K.C. | Deposition date: | 2024-10-22 | Release date: | 2025-10-22 |
|
PDBID: | 9h57 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of human mitochondrial ribosome small subunit bound to METTL15 and mS37 (State A7*) | Authors: | Khawaja, A., Singh, V., Shiriaev, D.I., Rorbach, J. | Deposition date: | 2024-10-22 |
|
PDBID: | 9k44 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Arabidopsis thaliana H2A-H3.3-nucleosome with Arabidopsis native 147bp DNA 15.2.2 (C2 symmetry) | Authors: | Wang, Y., Dong, A. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k45 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Arabidopsis thaliana H2A.Z-H3.3-nucleosome with Arabidopsis native 147bp DNA 15.2.2 (C2 symmetry) | Authors: | Wang, Y., Dong, A. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k46 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Arabidopsis thaliana H2A.W-H3.3-nucleosome with Arabidopsis native 147bp DNA 15.2.2 (C2 symmetry) | Authors: | Wang, Y., Dong, A. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k47 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of glomalin (a group I chaperonin) from Rhizophagus irregularis BGC BJ09 | Authors: | Wang, Y., Jia, M., Tan, W. | Deposition date: | 2024-10-21 |
|
PDBID: | 9e21 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of a broadly neutralizing anti-SARS-CoV-2 antibody 52 | Authors: | Jaiswal, D., Bajic, G. | Deposition date: | 2024-10-21 |
|
PDBID: | 9h4n | Status: | HPUB -- hold until publication | Title: | RPL13 (eL13)-mutant 80S ribosome from mouse | Authors: | Orgebin, E., Astier, A., Rinaldi, D., Baud''huin, M., Plisson-Chastang, C. | Deposition date: | 2024-10-21 |
|
PDBID: | 9h4u | Status: | HPUB -- hold until publication | Title: | Deacetylase FI8 utilizes unconventional variant of a catalytic triad: the diluted triad | Authors: | Palm, G.J., Lammers, M. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k3w | Status: | HPUB -- hold until publication | Title: | Crystal structure of putative transcription regulator (dr_2454) from Deinococcus radiodurans | Authors: | Khakerwala, Z., Kumar, A., Makde, R.D. | Deposition date: | 2024-10-20 |
|
PDBID: | 9k35 | Status: | HPUB -- hold until publication | Title: | Crystal structure of a (R)-selective transaminase (RTA) from Sphingopyxis sp. | Authors: | Qin, F.Y., Lee, K.M., Wong, K.B., Lee, K.H. | Deposition date: | 2024-10-18 |
|
PDBID: | 9k2q | Status: | AUTH -- processed, waiting for author review and approval | Title: | Preload capsid of phiYY, a prokaryotic dsRNA virus | Authors: | Huyan, Y.N., Meng, G. | Deposition date: | 2024-10-18 |
|
PDBID: | 9e0r | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of a single nucleosome (1) focus of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome | Authors: | Xie, X., Zhou, X.E., Worden, E.J., Jones, P.A. | Deposition date: | 2024-10-18 |
|
PDBID: | 9e0s | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of a the periplasmic insert from Myxococcus TAtC | Authors: | Deme, J.C., Bryant, O.J., Berks, B.C., Lea, S.M. | Deposition date: | 2024-10-18 | Sequence: | >Entity 1 (MSE)GS(MSE)FTFLLNEEETLALEQRLDTARLRADDALRFLRLGEAEEAGRIAKETSTQLRAEGQGQAPAPEVAPAASVE(MSE)TGRLDGLGRLLDAASVGYGAQSRGVLRQAVEKRVEAVTAYEKKDFAAAAAA(MSE)DGSASLLAGIAPTRTEELAGLWRLEKELATAHAAHEAARWTRP(MSE)LS(MSE)HEQLSENLYFQ
|
|
PDBID: | 9h4f | Status: | HPUB -- hold until publication | Title: | Structure of Imine Reductase 361 from Micromonospora sp. mutant M125W/I127F/L179V/H250L | Authors: | Ho, E., Domenech, J., Crossley, A., Green, A.P., Grogan, G. | Deposition date: | 2024-10-18 |
|
PDBID: | 9e00 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome | Authors: | Xie, X., Zhou, X.E., Worden, E.J., Jones, P.A. | Deposition date: | 2024-10-17 |
|
PDBID: | 9e05 | Status: | HPUB -- hold until publication | Title: | The consensus model of the cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome | Authors: | Xie, X., Zhou, X.E., Worden, E.J., Jones, P.A. | Deposition date: | 2024-10-17 |
|
PDBID: | 9e09 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure a single nucleosome (2) focus of human DNMT3A2-DNMT3B3 complex bound to di-nucleosome | Authors: | Xie, X., Zhou, X.E., Worden, E.J., Jones, P.A. | Deposition date: | 2024-10-17 |
|