| PDBID: | 9hi0 | | Status: | HOLD -- hold until a certain date | | Title: | STRUCTURE OF HUMAN UDP-GALACTOSE 4-EPIMERASE IN COMPLEX WITH COMPOUND WBX04 | | Authors: | Mouilleron, S., Schumann, B., Browne, W., Purkiss, A., Weckwerth, T., Ogrodowicz, R., Prema, R., Kunzelmann, S., Roustan, C. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9hi1 | | Status: | HOLD -- hold until a certain date | | Title: | STRUCTURE OF HUMAN UDP-GALACTOSE 4-EPIMERASE IN COMPLEX WITH COMPOUND WBX09 | | Authors: | Mouilleron, S., Schumann, B., Browne, W., Purkiss, A., Weckwerth, T., Ogrodowicz, R., Prema, R., Kunzelmann, S., Roustan, C. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9hi2 | | Status: | HOLD -- hold until a certain date | | Title: | STRUCTURE OF HUMAN UDP-GALACTOSE 4-EPIMERASE IN COMPLEX WITH COVALENT COMPOUND WBC10 | | Authors: | Mouilleron, S., Schumann, B., Browne, W., Purkiss, A., Weckwerth, T., Ogrodowicz, R., Prema, R., Kunzelmann, S., Roustan, C. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9hhz | | Status: | HPUB -- hold until publication | | Title: | [FeFe]-hydrogenase I from Clostridium pasteurianum (CpI), variant T275H | | Authors: | Veliju, A., Duan, J., Hofmann, E., Happe, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9hhr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of VSV-Indiana glycoprotein (MUDD-SUMMERS strain) in its post-fusion conformation in complex with 8G5F11 Fab | | Authors: | Albertini, A., Minoves, M.J., OuldAli, M., Gaudin, Y., Schoehn, G., Zarkadas, E. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9hhn | | Status: | HPUB -- hold until publication | | Title: | [FeFe]-hydrogenase I from Clostridium pasteurianum (CpI), variant T275Y | | Authors: | Veliju, A., Duan, J., Hofmann, E., Happe, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9hht | | Status: | HPUB -- hold until publication | | Title: | [FeFe]-hydrogenase I from Clostridium pasteurianum (CpI), variant T275F | | Authors: | Veliju, A., Duan, J., Hofmann, E., Happe, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9hhh | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease C111S of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhg | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhi | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease without zinc of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9egh | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of EgtUC binding domain mutant I243A bound to L-Ergothioneine from S. pneumoniae | | Authors: | Legg, K.A., Gonzalez-Gutierrez, G., Giedroc, D.P. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9egi | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of EgtUC binding domain mutant T274G bound to L-Ergothioneine from S. pneumoniae | | Authors: | Legg, K.A., Gonzalez-Gutierrez, G., Giedroc, D.P. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9egj | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of EgtUC binding domain mutant I243P bound to L-Ergothioneine from S. pneumoniae | | Authors: | Legg, K.A., Gonzalez-Gutierrez, G., Giedroc, D.P. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9eg9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human dihydroorotate dehydrogenase in complex with lapachol | | Authors: | Purificacao, A.D., Benz, L.S., Weiss, M.S., Nonato, M.C. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hgp | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase II in complex with a synthetic aromatic oligoamide foldamer | | Authors: | Sigl, J.C., Wang, L., Huc, I. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9kol | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a Ruthenium and Copper-substituted small laccase | | Authors: | Yang, X., Fan, S., Liu, J., Wu, W., Chen, X., Ji, W., Li, S., Xue, Y., Sun, X., Wang, M., Wu, F., Yu, P., Mao, L. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efn | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of Saccharomyces cerevisiae cross-linked Sfh1 (K197C, F233C) mutant in complex with phosphatidylethanolamine | | Authors: | Green, S.M., Laganowsky, A., Krieger, I., Singh, P.K., Igumenova, T.I., Bankaitis, V.A., Sacchettini, J. | | Deposition date: | 2024-11-20 | | Release date: | 2025-11-20 |
|
| PDBID: | 9efp | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Saccharomyces cerevisiae Sec14p in complex with phosphatidylcholine | | Authors: | Green, S.M., Laganowsky, A., Krieger, I., Singh, P.K., Igumenova, T.I., Bankaitis, V.A., Sacchettini, J. | | Deposition date: | 2024-11-20 | | Release date: | 2025-11-20 |
|
| PDBID: | 9efl | | Status: | HPUB -- hold until publication | | Title: | Structure of a GH16_17 carrageenase from a metagenomic dataset. | | Authors: | Boraston, A.B., Tingley, J., Mihalynuk, L., Abbott, D.W. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9hge | | Status: | HPUB -- hold until publication | | Title: | PB1 domain of p62/SQSTM1 | | Authors: | Berkamp, S., Jungbluth, L., Katranidis, A., Mostafavi, S., Sachse, C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9knr | | Status: | HPUB -- hold until publication | | Title: | PSI-SOD supercomplex from Chromera velia | | Authors: | Feng, Y., Huang, K., Li, X.B., Amunts, A. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ko0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a novel alpha/beta hydrolase from Pyrinomonas methylaliphatogenes | | Authors: | Jian, G., Li, W.S., Wei, H.L., Li, Q., Chen, Y.Y., Wu, P., Han, X., Liu, W. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ko1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a novel alpha/beta hydrolase mutant from from Pyrinomonas methylaliphatogenes | | Authors: | Li, W.S., Jian, G., Wu, P., Chen, Y.Y., Li, Q., Han, X., Liu, W. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9edu | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-S112C bound to Cu(II)dpea cofactor | | Authors: | Minnetian, N.M., Borovik, A.S., Follmer, A.H. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9edr | | Status: | HPUB -- hold until publication | | Title: | Tubulin Cofactors D,E,G,C and Tubulin complex -- TBCC N Terminus Bound to Tubulin | | Authors: | Taheri, A., Al-bassam, J. | | Deposition date: | 2024-11-17 |
|
