| PDBID: | 9u7o | | Status: | HPUB -- hold until publication | | Title: | Tetrameric cystathionine beta-synthase of Mycobacterium tuberculosis bound to AOAA | | Authors: | Roy, A., Polepalli, S., Mondal, B., Dutta, S. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9u7n | | Status: | HPUB -- hold until publication | | Title: | Tetrameric cystathionine beta-synthase of Mycobacterium tuberculosis bound to O-Benzylhydroxylamine | | Authors: | Polepalli, S., Roy, A., Mondal, B., Dutta, S. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9nx4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of a P. Aeruginosa Gyrase Chimera In Complex with 20mer DNA and Ciprofloxacin | | Authors: | Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9nx5 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of a P. Aeruginosa Gyrase | | Authors: | Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnm | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2 | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qns | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnn | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnu | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of Nanofitin C10 - fused to a coiled-coil domain - in complex with a C2 symmetric 31unit aromatic oligoamide foldamer | | Authors: | Sigl, J.C., Wang, L., Douat, C., Huc, I. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnq | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnw | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSIKIK
|
|
| PDBID: | 9qny | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., KowaleWski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnx | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9u7g | | Status: | HPUB -- hold until publication | | Title: | FGFR1 kinase domain with a macrocyclic compound 8g | | Authors: | Chen, X.J., Chen, Y.H. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Single-particle cryo-EM structure of the first variant of mobilized colistin resistance (MCR-1) in its ligand-bound state | | Authors: | Zinkle, A.P., Bunuro-Batista, M., Herrera, C.M., Erramilli, S.K., Kloss, B., Ashraf, K.U., Nosol, K., Zhang, G., Cater, R.J., Marty, M.T., Kossiakoff, A.A., Trent, M.S., Nygaard, R., Stansfeld, P.J., Mancia, F. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycine-betaine demethylase subunit GbcA from Pseudomonas aeruginosa | | Authors: | Tan, K., Joachimiak, A., Munoz-Clares, R.A. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwx | | Status: | HPUB -- hold until publication | | Title: | Discovery of a Small Molecule ITK and Pan-TRK Kinase Inhibitor (PF-07245303) for the Potential Topical Treatment of Atopic Dermatitis | | Authors: | Liu, S. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i90 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 7 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i91 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 13 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i92 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 9 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i93 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 27 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i95 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 25 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i96 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 4 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i97 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 8 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i98 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 10 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i99 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 22 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
