| PDBID: | 9bxf | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH HZ-IV-236 | | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bxg | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH HZ-IV-242 | | Authors: | Tolbert, W.D., Niu, L., Pazgier, M. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bxr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Straight Filaments purified from Down Syndrome individual brain tissue applied to graphene oxide antibody affinity grids | | Authors: | Tse, E., Ghosh, U., Condello, C., Southworth, D. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bwn | | Status: | HPUB -- hold until publication | | Title: | Nanoparticle Crystal Structure of a Thermostabilized Mutant Rv1498A Flavoprotein from Mycobacterium tuberculosis | | Authors: | Seraj, N., Cappelli, L., Wahome, N., Cinelli, P., Fabiola, G., Cartocci, E., Delany, I., Cozzi, R. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwe | | Status: | HPUB -- hold until publication | | Title: | Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine at pH 6.4 in an intermediate state | | Authors: | Kindig, K., Gibbs, E., Chakrapani, S. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwj | | Status: | HPUB -- hold until publication | | Title: | Homomeric alpha3 glycine receptor in the presence of 0.1 mM glycine and 0.1 mM zinc in an apo state | | Authors: | Kindig, K., Gibbs, E., Chakrapani, S. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwm | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Oxidized Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bwq | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to the Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bwr | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to the Neutron Structure of Reduced Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 8zlp | | Status: | HPUB -- hold until publication | | Title: | apo WT polymorph 5a alpha-synuclein fibril | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8zlo | | Status: | HPUB -- hold until publication | | Title: | F0502B-bound E46K alpha-synuclein fibril | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8zli | | Status: | HPUB -- hold until publication | | Title: | BTA-2-bound E46K alpha-synuclein fibrils | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvy | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Peroxide-Soaked Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-20 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bw2 | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Reduced Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-20 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bu4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an MKP5 mutant, Y435W, in complex with an allosteric inhibitor | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bqk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA*02:01 with the 11-mer TP53 peptide GLAPPQHLIRV | | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9bqu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA*02:01 with the 11-mer TP53 mutant peptide GLAPPQHLFRV | | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 9f9y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SARS-CoV-2 BA-2.87.1 Spike ectodomain | | Authors: | Ren, J., Stuart, D.I., Duyvesteyn, H.M.E. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9f8y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a designed three-motif Respiratory Syncytial Virus immunogen | | Authors: | Castro, K.M., Correia, B.E. | | Deposition date: | 2024-05-07 |
|
| PDBID: | 9f91 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a designed Respiratory Syncytial Virus immunogen in complex with RSV90 fab | | Authors: | Castro, K.M., Correia, B.E. | | Deposition date: | 2024-05-07 |
|
| PDBID: | 9f90 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of a designed three-motif Respiratory Syncytial Virus immunogen in complex with motavizumab fab | | Authors: | Castro, K.M., Correia, B.E. | | Deposition date: | 2024-05-07 |
|
| PDBID: | 8zex | | Status: | HPUB -- hold until publication | | Title: | Biosensor HaloKbp1a | | Authors: | Wen, Y., Campbell, R.E. | | Deposition date: | 2024-05-07 |
|
| PDBID: | 8zfi | | Status: | HPUB -- hold until publication | | Title: | Structure of E.coli ribosome in complex with an engineered arrest peptide and trigger factor | | Authors: | Sriramoju, M.K., Ko, T.P., Draczkowski, P., Hsu, S.T.D. | | Deposition date: | 2024-05-07 |
|
| PDBID: | 9bpn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the allosteric MKP5 mutant Y435W | | Authors: | Manjula, R., Bennett, A.M., Lolis, E. | | Deposition date: | 2024-05-07 |
|
| PDBID: | 9bpf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of main protease of SARS-CoV-2 complexed with inhibitor | | Authors: | Chen, P., Arutyunova, E., Lemieux, M.J. | | Deposition date: | 2024-05-07 |
|
