| PDBID: | 9e43 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and Phosphonoacetate | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e44 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and 2-Phosphonopropionic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e45 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and 1-Hydroxypropylphosphonic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C., Garneau-Tsodikova, S., Thamban Chandrika, N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e46 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and (1-Hydroxy-2-methylpropyl)phosphonic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C., Garneau-Tsodikova, S., Thamban Chandrika, N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e47 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and (1-Hydroxypropan-2-yl)phosphonic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C., Garneau-Tsodikova, S., Thamban Chandrika, N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9dy6 | | Status: | HPUB -- hold until publication | | Title: | Structure of PmHMGR bound to mevalonate, CoA and NAD 4 minutes after reaction initiation at pH 9 | | Authors: | Purohit, V., Steussy, C.N., Schmidt, T., Stauffacher, C.V., Rushton, P. | | Deposition date: | 2024-10-13 | | Release date: | 2026-04-12 | | Sequence: | >Entity 1
MSLDSRLPAFRNLSPAARLDHIGQLLGLSHDDVSLLANAGALPMDIANGMIENVIGTFELPYAVASNFQINGRDVLVPLVVEEPSIVAAASYMAKLARANGGFTTSSSAPLMHAQVQIVGIQDPLNARLSLLRRKDEIIELANRKDQLLNSLGGGCRDIEVHTFADTPRGPMLVAHLIVDVRDAMGANTVNTMAEAVAPLMEAITGGQVRLRILSNLADLRLARAQVRITPQQLETAEFSGEAVIEGILDAYAFAAVDPYRAATHNKGIMNGIDPLIVATGNDWRAVEAGAHAYACRSGHYGSLTTWEKDNNGHLVGTLEMPMPVGLVGGATKTHPLAQLSLRILGVKTAQALAEIAVAVGLAQNLGAMRALATEGIQRGHMALHARNIAVVAGARGDEVDWVARQLVEYHDVRADRAVALLKQKRGQ
|
|
| PDBID: | 9h0t | | Status: | HPUB -- hold until publication | | Title: | N terminal domain of BC2L-C lectin (1-131) in complex with a beta-fucosylamide side-product | | Authors: | Antonin, G., Varrot, A. | | Deposition date: | 2024-10-09 | | Release date: | 2026-04-09 | | Sequence: | >Entity 1
GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
| PDBID: | 9h0u | | Status: | HPUB -- hold until publication | | Title: | N terminal domain of BC2L-C lectin (1-131) with covalent beta-fucosylamide ligand | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-10-09 | | Release date: | 2026-04-09 | | Sequence: | >Entity 1
GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
| PDBID: | 9jvj | | Status: | HPUB -- hold until publication | | Title: | Structure of P450BytO mutant V219H in complex with pentapeptide MRYYH | | Authors: | Wang, H.Q., Xu, C., Ye, T., Xiang, Z. | | Deposition date: | 2024-10-09 | | Release date: | 2026-04-09 |
|
| PDBID: | 9ju3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 3-fold Block-refine of Full particle of phiYY, a prokaryotic dsRNA virus | | Authors: | Meng, K.W., Cui, C.X., HuYan, Y.N., Zhang, X.Z., Meng, G. | | Deposition date: | 2024-10-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9dsg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the SARS-CoV-2 RBD in complex with the cow antibody P2 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 | | Release date: | 2025-12-26 |
|
| PDBID: | 9dsh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the cow antibody P7 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 | | Release date: | 2025-12-26 |
|
| PDBID: | 9dsi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the cow antibody 99 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 | | Release date: | 2025-12-26 |
|
| PDBID: | 9dsj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the cow antibody 105 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 | | Release date: | 2025-12-26 |
|
| PDBID: | 9dsk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the cow antibody 115 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 | | Release date: | 2025-12-26 |
|
| PDBID: | 9dpd | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of SerRS dimer in complex with one SIRT2 | | Authors: | Yang, J., Zhang, Q., Lander, G.C., Yang, X. | | Deposition date: | 2024-09-21 |
|
| PDBID: | 9dpg | | Status: | HPUB -- hold until publication | | Title: | Structure of PmHMGR bound to mevalonate, CoA and NAD 2 minutes 20 seconds after reaction initiation at pH 9 | | Authors: | Purohit, V., Steussy, C.N., Schmidt, T., Stauffacher, C.V., Rushton, P. | | Deposition date: | 2024-09-21 | | Release date: | 2026-03-20 | | Sequence: | >Entity 1
MSLDSRLPAFRNLSPAARLDHIGQLLGLSHDDVSLLANAGALPMDIANGMIENVIGTFELPYAVASNFQINGRDVLVPLVVEEPSIVAAASYMAKLARANGGFTTSSSAPLMHAQVQIVGIQDPLNARLSLLRRKDEIIELANRKDQLLNSLGGGCRDIEVHTFADTPRGPMLVAHLIVDVRDAMGANTVNTMAEAVAPLMEAITGGQVRLRILSNLADLRLARAQVRITPQQLETAEFSGEAVIEGILDAYAFAAVDPYRAATHNKGIMNGIDPLIVATGNDWRAVEAGAHAYACRSGHYGSLTTWEKDNNGHLVGTLEMPMPVGLVGGATKTHPLAQLSLRILGVKTAQALAEIAVAVGLAQNLGAMRALATEGIQRGHMALHARNIAVVAGARGDEVDWVARQLVEYHDVRADRAVALLKQKRGQ
|
|
| PDBID: | 9dot | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of LptB2FGCH | | Authors: | Su, C.C. | | Deposition date: | 2024-09-19 | | Release date: | 2026-03-18 |
|
| PDBID: | 9jlp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Full particle of prokaryotic dsRNA virus phiYY | | Authors: | Meng, K.W., Cui, C.X., Huyan, Y.N., Meng, G. | | Deposition date: | 2024-09-19 | | Release date: | 2026-03-19 |
|
| PDBID: | 9jkr | | Status: | HOLD -- hold until a certain date | | Title: | human GM-CSF with Fabs from autoantibodies, F1 and C. | | Authors: | Kishikawa, J., Kato, T., Kurosaki, T., Inoue, T. | | Deposition date: | 2024-09-17 | | Release date: | 2026-03-17 |
|
| PDBID: | 9jih | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of BAR domain of ACAP4 | | Authors: | Huang, S., Chen, J.S., Wang, C. | | Deposition date: | 2024-09-11 | | Release date: | 2026-03-11 |
|
| PDBID: | 9diw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the SARS-CoV-2 main protease in complex with a covalent tripeptidyl inhibitors | | Authors: | Engel, J.E., Al-Homoudi, A.I., Muczynski, M.D., Brunzelle, J.S., Kovari, L.C. | | Deposition date: | 2024-09-06 | | Release date: | 2026-03-05 |
|
| PDBID: | 9di7 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of STAT3 and VHL:EloB:EloC complex, mediated by heterobifunctional degrader KT-333 | | Authors: | Sharma, K., Huang, X., Breitkopf, S., Browne, C.M., Chutake, Y., Csibi, A., Daigle, C.A., De Savi, C., Dey, J., Dixit, V., Enerson, B., Fasciano, A.C., Fei, X., Growney, J., Harsch, A., Ji, N., Kamaduri, H., Karnik, R., Kuhn, E., Liu, P.C., Mahasenan, K.V., Mayo, M., Ramanathan, A., Rong, H., Rusin, S., Shaw, J., Shi, Y., Su, L., Walther, D.M., Yuan, K., Mainolfi, N., Yang, B. | | Deposition date: | 2024-09-05 | | Release date: | 2026-03-04 |
|
| PDBID: | 9gol | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of limonene epoxide hydrolase LEH 19 | | Authors: | Levy, C.W. | | Deposition date: | 2024-09-05 | | Release date: | 2026-03-05 |
|
| PDBID: | 9gom | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of limonene epoxide hydrolase LEH 31 | | Authors: | Levy, C.W. | | Deposition date: | 2024-09-05 | | Release date: | 2026-03-05 |
|
