Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9uaf
Status:HPUB -- hold until publication
Title:Crystal structure of the OkaE-M71A mutant with a-ketoglutarate
Authors:Yu, J.J., Yan, W.P., Wang, X.Y.
Deposition date:2025-03-31
PDBID:9uag
Status:HPUB -- hold until publication
Title:Crystal structure of the OkaE-M71A mutant with a-ketoglutarate and okaramine A
Authors:Yu, J.J., Yan, W.P., Wang, X.Y.
Deposition date:2025-03-31
PDBID:9uah
Status:HPUB -- hold until publication
Title:Crystal structure of the OkaE-W79A mutant with a-ketoglutarate and okaramine A
Authors:Yu, J.J., Yan, W.P., Wang, X.Y.
Deposition date:2025-03-31
PDBID:9nzf
Status:HPUB -- hold until publication
Title:Crystal structure of Fab MAM01 in complex with minor repeat region peptide from circumsporozoite protein
Authors:Jain, M., Wilson, I.A.
Deposition date:2025-03-31
PDBID:9nzc
Status:HPUB -- hold until publication
Title:Crystal structure of AfNth1:Tg-DNA duplex complex in a pre-intermediate state
Authors:Syed, A., Arvai, A.S., Tsai, C.L., Tainer, J.A.
Deposition date:2025-03-31
PDBID:9nzd
Status:HPUB -- hold until publication
Title:Crystal structure of AfNth1-K122A mutant bound to Tg-DNA duplex complex in an intermediate state
Authors:Hitomi, K., Arvai, A.S., Syed, A., Parikh, S., Tainer, J.A.
Deposition date:2025-03-31
PDBID:9nz0
Status:HPUB -- hold until publication
Title:Cryo-EM structure of vaccine elicited antibody 22F5 bound to the post-fusion conformation of the LayV-F glycoprotein.
Authors:Kumar, U., May, A., Acharya, P.
Deposition date:2025-03-31
PDBID:9nz2
Status:HPUB -- hold until publication
Title:Cryo-EM structure of antibody 22F5 in complex with pre-fusion stabilized LayV-F
Authors:May, A.J., Kumar, U., Acharya, P.
Deposition date:2025-03-31
PDBID:9qqi
Status:HPUB -- hold until publication
Title:Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 untreated control of a redox cycling experiment
Authors:Wissink, M., Wagner, T.
Deposition date:2025-03-31
Sequence:

>Entity 1


MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
PDBID:9qq3
Status:HPUB -- hold until publication
Title:Crystal structure of human carbonic anhydrase VII in complex with a benzenesufonamide derivative containing the duloxetine moiety
Authors:D''Ambrosio, K., Di Fiore, A., De Simone, G.
Deposition date:2025-03-31
PDBID:9qq2
Status:HPUB -- hold until publication
Title:Crystal structure of human carbonic anhydrase VII in complex with a benzenesulfonamide derivative containing the duloxetine moiety.
Authors:Di Fiore, A., D''Ambrosio, K., De Simone, G.
Deposition date:2025-03-31
PDBID:9qq5
Status:HPUB -- hold until publication
Title:Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 in a partially oxidized state
Authors:Wissink, M., Wagner, T.
Deposition date:2025-03-31
Sequence:

>Entity 1


MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
PDBID:9qqf
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the WIM8E5 Fab - HLA-A*11:01 human alloantibody-HLA complex
Authors:Zampieri, V., Priddey, A., Humm, A.S., Pellegrini, E., Heidt, S., Kosmoliaptsis, V., Marquez, J.A.
Deposition date:2025-03-31
PDBID:9qq4
Status:AUTH -- processed, waiting for author review and approval
Title:Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 as isolated form at 1.07-A resolution
Authors:Wissink, M., Wagner, T.
Deposition date:2025-03-31
PDBID:9qqe
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the SN230G6 Fab - HLA-A*02:01 human alloantibody-HLA complex
Authors:Zampieri, V., Priddey, A., Schneider, S., Heidt, S., Kosmoliaptsis, V., Marquez, J.A.
Deposition date:2025-03-31
PDBID:9u9m
Status:HPUB -- hold until publication
Title:2,2''-bipyridine linked DNA oligomer (CGCGAAT[BrU]CGCG) in the presence of Ni2+ ion
Authors:Atugi, T., Kanazawa, H., Sugiyama, Y., Fujiwara, S., Ono, A., Kondo, J.
Deposition date:2025-03-28
PDBID:9nyq
Status:HPUB -- hold until publication
Title:Crystal structure of CDK2/CyclinE1 in complex with Cpd 3
Authors:Collier, P., Zheng, X., Ford, M., Weiss, M., Aversa, R., Chen, D., Li, K., Growney, J.D., Yang, A., Sathappa, M., Breitkopf, S.B., Enerson, B., Sawant, R., Su, L., Howarth, L., Liang, T., Paul, A., Sharma, K., Williams, J., Kwiatkowski, N.P.
Deposition date:2025-03-28
PDBID:9nyr
Status:HPUB -- hold until publication
Title:Cryo-EM structure of CDK2/CyclinE1 in complex with CRBN/DDB1 and Cpd 24
Authors:Collier, P., Zheng, X., Ford, M., Weiss, M., Aversa, R., Chen, D., Li, K., Growney, J.D., Yang, A., Sathappa, M., Breitkopf, S.B., Enerson, B., Sawant, R., Su, L., Howarth, L., Liang, T., Paul, A., Sharma, K., Williams, J., Kwiatkowski, N.P.
Deposition date:2025-03-28
PDBID:9nys
Status:HPUB -- hold until publication
Title:Human DNA Ligase 1 E346A/E592A/K845N triple mutant with 3''-A:T nick
Authors:KanalElamparithi, B., Caglayan, M.
Deposition date:2025-03-28
PDBID:9nyc
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the glycosyltransferase GtrB in the substrate-bound state
Authors:Morgan, R.T., Motta, S., Gil-Iturbe, E., Bhattacharjee, B., di Muccio, G., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F.
Deposition date:2025-03-27
PDBID:9nyd
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of the glycosyltransferase GtrB in the pre-catalysis and product-bound state
Authors:Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F.
Deposition date:2025-03-27
PDBID:9nye
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the glycosyltransferase GtrB in the apo state (octamer volume)
Authors:Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F.
Deposition date:2025-03-27
PDBID:9nyk
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the glycosyltransferase GtrB in the pre-intermediate state
Authors:Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F.
Deposition date:2025-03-27
PDBID:9nyj
Status:HPUB -- hold until publication
Title:MoaC-pyranopterin [(alpha-beta-methyleno]triphosphate covalent complex in the absence of Mg2+
Authors:Schumacher, M.A., Yokoyama, K.
Deposition date:2025-03-27
PDBID:9nyf
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the glycosyltransferase GtrB (tetramer volume)
Authors:Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F.
Deposition date:2025-03-27

243911

PDB entries from 2025-10-29

PDB statisticsPDBj update infoContact PDBjnumon