| PDBID: | 8rjr | | Status: | HPUB -- hold until publication | | Title: | Serial femtosecond X-ray structure of a fluorescence optimized bathy phytochrome PAiRFP2 derived from wild-type Agp2 in I4 intermediate state. | | Authors: | Sauthof, L., Schmidt, A., Szczepek, M., Brewster, A.S., Kern, J.F., Scheerer, P. | | Deposition date: | 2023-12-21 |
|
| PDBID: | 8rjs | | Status: | HPUB -- hold until publication | | Title: | Serial femtosecond X-ray structure of a fluorescence optimized bathy phytochrome PAiRFP2 derived from wild-type Agp2 in I5 intermediate state. | | Authors: | Sauthof, L., Schmidt, A., Szczepek, M., Brewster, A.S., Kern, J.F., Scheerer, P. | | Deposition date: | 2023-12-21 |
|
| PDBID: | 8rju | | Status: | HPUB -- hold until publication | | Title: | Serial femtosecond X-ray structure of a fluorescence optimized bathy phytochrome PAiRFP2 derived from wild-type Agp2 in I7 intermediate state. | | Authors: | Sauthof, L., Schmidt, A., Szczepek, M., Brewster, A.S., Kern, J.F., Scheerer, P. | | Deposition date: | 2023-12-21 |
|
| PDBID: | 8rjh | | Status: | HPUB -- hold until publication | | Title: | HLA A*2402-NF9_6F pMHC complex | | Authors: | Wall, A., Sewell, A.K., Motozono, C., Rizkallah, P.J., Fuller, A. | | Deposition date: | 2023-12-21 |
|
| PDBID: | 8rji | | Status: | HPUB -- hold until publication | | Title: | HLA A*2402-NF9_5R pMHC complex | | Authors: | Wall, A., Motozono, C., Sewell, A.K., Rizkallah, P.J., Fuller, A. | | Deposition date: | 2023-12-21 |
|
| PDBID: | 8rjt | | Status: | HPUB -- hold until publication | | Title: | Serial femtosecond X-ray structure of a fluorescence optimized bathy phytochrome PAiRFP2 derived from wild-type Agp2 in I6 intermediate state. | | Authors: | Sauthof, L., Schmidt, A., Szczepek, M., Brewster, A.S., Kern, J.F., Scheerer, P. | | Deposition date: | 2023-12-21 |
|
| PDBID: | 8xjc | | Status: | HPUB -- hold until publication | | Title: | a novel haemophore of of Riemerella anatipestifer | | Authors: | Zhang, D.D., Chen, T.T. | | Deposition date: | 2023-12-21 |
|
| PDBID: | 8rj7 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the neutralizing nanobody 1.29 | | Authors: | Casasnovas, J.M., Fernandez, L.A., Silva, K. | | Deposition date: | 2023-12-20 |
|
| PDBID: | 8rj5 | | Status: | HOLD -- hold until a certain date | | Title: | P1-15 T-cell Receptor bound to HLA A*2402-NF9 pMHC complex | | Authors: | Wall, A., Sewell, A.K., Motozono, C., Rizkallah, P.J., Fuller, A. | | Deposition date: | 2023-12-20 | | Release date: | 2024-12-20 |
|
| PDBID: | 8rj8 | | Status: | HPUB -- hold until publication | | Title: | CytK nanopore mutant | | Authors: | Whittaker, J.J., Sauciuc, A., Guskov, A. | | Deposition date: | 2023-12-20 |
|
| PDBID: | 8rip | | Status: | HPUB -- hold until publication | | Title: | Beta-keto acid cleavage enzyme from Paracoccus denitrificans with bound malonate and Coenzyme A | | Authors: | Marchal, D.G., Zarzycki, J., Erb, T.J. | | Deposition date: | 2023-12-19 |
|
| PDBID: | 8xic | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Trioxacarcin A covalently bound to guanosine-2''-fluorinated d(AACCGGTT)2 | | Authors: | Gao, R.Q., Cao, C., Tang, G.L. | | Deposition date: | 2023-12-19 | | Release date: | 2024-12-19 |
|
| PDBID: | 8rib | | Status: | HPUB -- hold until publication | | Title: | N-terminal domain of Trypanosoma brucei PEX14 in complex with a pyrazolo-pyrazolo[4,3-c]pyridin-3-yl compound showing a novel binding pose | | Authors: | Napolitano, V., Janna Olmos, J., Popowicz, G.M., Dubin, G. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8ri1 | | Status: | HPUB -- hold until publication | | Title: | BmrA E504-100uMATPMg | | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8ria | | Status: | HPUB -- hold until publication | | Title: | BmrA E504-100uMATPMg-IF | | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8rie | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of oligosaccharide dehydrogenase from Pycnoporus cinnabarinus bound to Guaiacol, orthorhombic crystal | | Authors: | Savino, C., Sciara, G., Gugole, E., Vallone, B., Fata, F., Bulfaro, G., Costanzo, A., Montemiglio, L.C. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8ric | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of oligosaccharide dehydrogenase from Pycnoporus cinnabarinus bound to Sinapic Acid, tetragonal crystal | | Authors: | Savino, C., Sciara, G., Gugole, E., Vallone, B., Fata, F., Bulfaro, G., Costanzo, A., Montemiglio, L.C. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8rid | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of oligosaccharide dehydrogenase from Pycnoporus cinnabarinus bound to Sinapic Acid, orthorhombic crystal | | Authors: | Savino, C., Sciara, G., Gugole, E., Vallone, B., Fata, F., Bulfaro, G., Costanzo, A., Montemiglio, L.C. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8vdx | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of bacterial extracellular solute-binding protein from Bordetella bronchiseptica RB50 | | Authors: | Chang, C., Tesar, C., Endres, M., Joachimiak, A., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8xgs | | Status: | HPUB -- hold until publication | | Title: | a peptide receptor complex structure | | Authors: | Wu, Z., Du, Y., Chen, G. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgu | | Status: | HPUB -- hold until publication | | Title: | a peptide receptor complex structure | | Authors: | Wu, Z., Du, Y., Chen, G. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8rgn | | Status: | HPUB -- hold until publication | | Title: | BmrA E504-R6G-70uMATPMg | | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8rgm | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of nucleosome containing Widom603 DNA | | Authors: | Motorin, N.A., Afonin, D., Armeev, G.A., Moiseenko, A., Zhao, L., Vasiliev, V., Oleinikov, P., Shaytan, A., Shi, X., Studitsky, V., Sokolova, O. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rMcL-1 in complex with galactose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vco | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
