PDBID: | 9mpx | Status: | HPUB -- hold until publication | Title: | Crystal structure of RM014, a macaque-derived HIV V2-apex-targeting antibody from ApexGT6 immunization | Authors: | Agrawal, S., Wilson, I.A. | Deposition date: | 2024-12-31 |
|
PDBID: | 9mpc | Status: | HPUB -- hold until publication | Title: | Crystal structure of the HIV V2-apex-targeting antibody RM018 from macaque | Authors: | Agrawal, S., Wilson, I.A. | Deposition date: | 2024-12-30 |
|
PDBID: | 9mpb | Status: | HPUB -- hold until publication | Title: | Crystal structure of the HIV V2-apex-targeting antibody RM038, derived from macaque ApexGT6 immunization | Authors: | Agrawal, S., Wilson, I.A. | Deposition date: | 2024-12-30 |
|
PDBID: | 9l8e | Status: | HPUB -- hold until publication | Title: | Structure of Gh-TDH with Additional N-Terminus in Complex with Double-Stranded DNA Containing a 2-Nucleotide 5'' Overhang | Authors: | Hsiao, P.Y., Wu, T.K., Chang, C.Y. | Deposition date: | 2024-12-27 |
|
PDBID: | 9l8j | Status: | HPUB -- hold until publication | Title: | Crystal structure of a putative phosphate binding protein from Synechocystis sp. PCC 6803 reveals an evolutionary hotspot | Authors: | Wang, C.Y., Ma, H.L., Lu, Y.P. | Deposition date: | 2024-12-27 |
|
PDBID: | 9mof | Status: | HPUB -- hold until publication | Title: | Structure of the bacteriophage T4 portal-neck-tail connector complex | Authors: | Fokine, A., Zhu, J., Klose, T., Vago, F., Arnaud, C., Wang, Z., Khare, B., Rossmann, M.G., Chen, Z., Sun, L., Fang, Q., Kuhn, R., Rao, V.B. | Deposition date: | 2024-12-26 |
|
PDBID: | 9moh | Status: | HPUB -- hold until publication | Title: | Structure of the middle part of the bacteriophage T4 tail | Authors: | Fokine, A., Zhu, J., Klose, T., Vago, F., Arnaud, C., Wang, Z., Khare, B., Rossmann, M.G., Chen, Z., Sun, L., Fang, Q., Kuhn, R., Rao, V.B. | Deposition date: | 2024-12-26 |
|
PDBID: | 9mog | Status: | HPUB -- hold until publication | Title: | Structure of the distal part of the bacteriophage T4 tail | Authors: | Fokine, A., Zhu, J., Klose, T., Vago, F., Arnaud, C., Wang, Z., Khare, B., Rossmann, M.G., Chen, Z., Sun, L., Fang, Q., Kuhn, R., Rao, V.B. | Deposition date: | 2024-12-26 |
|
PDBID: | 9hva | Status: | HPUB -- hold until publication | Title: | Crystal structure of Fab34 complexed with a 18-mer peptide of FMDV VP1 | Authors: | Ren, J., Duyvesteyn, H.M.E., Stuart, D.I. | Deposition date: | 2024-12-25 |
|
PDBID: | 9l75 | Status: | HOLD -- hold until a certain date | Title: | A novel PE hydrolase and its structural basis | Authors: | Wang, Y.S., Sun, D.Y., Jia, H.H., Sun, Y.Z., Qiu, L.N. | Deposition date: | 2024-12-25 | Release date: | 2025-12-25 |
|
PDBID: | 9l6v | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of A. thaliana H2A.W nucleosome | Authors: | Liu, X., Gong, Q.Y. | Deposition date: | 2024-12-25 |
|
PDBID: | 9hv3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human GSK3b in complex with ARN25657 | Authors: | Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G. | Deposition date: | 2024-12-24 |
|
PDBID: | 9hv9 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Fab34 complexed with a 7-mer peptide of FMDV VP1 | Authors: | Ren, J., Duyvesteyn, H.M.E., Stuart, D.I. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l63 | Status: | HPUB -- hold until publication | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | Authors: | Jiang, J., Fang, P. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l64 | Status: | HPUB -- hold until publication | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | Authors: | Jiang, J., Fang, P. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l65 | Status: | HPUB -- hold until publication | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | Authors: | Jiang, J., Fang, P. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l6e | Status: | HPUB -- hold until publication | Title: | A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures | Authors: | Jiang, J., Fang, P. | Deposition date: | 2024-12-24 |
|
PDBID: | 9l6m | Status: | HPUB -- hold until publication | Title: | Crystal Structure of BRD2 BD1 domain in complex with small molecule inhibitor Isoxazole azepine compound. | Authors: | Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K. | Deposition date: | 2024-12-24 | Sequence: | >Entity 1 MGSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
|
|
PDBID: | 9l6p | Status: | HPUB -- hold until publication | Title: | Cryo-electron microscopic structure of a highly efficient ochratoxin detoxification enzyme LlADH | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., Niu, D., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Guo, R.-T., Chen, C.-C. | Deposition date: | 2024-12-24 |
|
PDBID: | 9mo3 | Status: | HPUB -- hold until publication | Title: | LINE-1 Reverse Transcriptase bound to an incorporated inhibitor-terminated DNA primer RNA template duplex and dTTP as the incoming base | Authors: | Nichols, C., Viacava Follis, A. | Deposition date: | 2024-12-24 |
|
PDBID: | 9mo1 | Status: | HPUB -- hold until publication | Title: | LINE-1 Reverse Transcriptase bound to a DNA primer RNA template duplex and triphosphate nucleoside inhibitor as the incoming base | Authors: | Nichols, C., Viacava Follis, A. | Deposition date: | 2024-12-24 |
|
PDBID: | 9huh | Status: | HPUB -- hold until publication | Title: | CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in 10 mM calcium | Authors: | Bereta, G.P., Bielecka, E., Biela, A.P., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T. | Deposition date: | 2024-12-23 |
|
PDBID: | 9hus | Status: | HOLD -- hold until a certain date | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 31, with P-site tRNAs | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | Deposition date: | 2024-12-23 | Release date: | 2025-12-23 |
|
PDBID: | 9huq | Status: | HPUB -- hold until publication | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site tRNA | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | Deposition date: | 2024-12-23 |
|
PDBID: | 9huk | Status: | HPUB -- hold until publication | Title: | Crystal structure of human GSK3b in complex with ARN24161 | Authors: | Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G. | Deposition date: | 2024-12-23 |
|