Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9mpx
Status:HPUB -- hold until publication
Title:Crystal structure of RM014, a macaque-derived HIV V2-apex-targeting antibody from ApexGT6 immunization
Authors:Agrawal, S., Wilson, I.A.
Deposition date:2024-12-31
PDBID:9mpc
Status:HPUB -- hold until publication
Title:Crystal structure of the HIV V2-apex-targeting antibody RM018 from macaque
Authors:Agrawal, S., Wilson, I.A.
Deposition date:2024-12-30
PDBID:9mpb
Status:HPUB -- hold until publication
Title:Crystal structure of the HIV V2-apex-targeting antibody RM038, derived from macaque ApexGT6 immunization
Authors:Agrawal, S., Wilson, I.A.
Deposition date:2024-12-30
PDBID:9l8e
Status:HPUB -- hold until publication
Title:Structure of Gh-TDH with Additional N-Terminus in Complex with Double-Stranded DNA Containing a 2-Nucleotide 5'' Overhang
Authors:Hsiao, P.Y., Wu, T.K., Chang, C.Y.
Deposition date:2024-12-27
PDBID:9l8j
Status:HPUB -- hold until publication
Title:Crystal structure of a putative phosphate binding protein from Synechocystis sp. PCC 6803 reveals an evolutionary hotspot
Authors:Wang, C.Y., Ma, H.L., Lu, Y.P.
Deposition date:2024-12-27
PDBID:9mof
Status:HPUB -- hold until publication
Title:Structure of the bacteriophage T4 portal-neck-tail connector complex
Authors:Fokine, A., Zhu, J., Klose, T., Vago, F., Arnaud, C., Wang, Z., Khare, B., Rossmann, M.G., Chen, Z., Sun, L., Fang, Q., Kuhn, R., Rao, V.B.
Deposition date:2024-12-26
PDBID:9moh
Status:HPUB -- hold until publication
Title:Structure of the middle part of the bacteriophage T4 tail
Authors:Fokine, A., Zhu, J., Klose, T., Vago, F., Arnaud, C., Wang, Z., Khare, B., Rossmann, M.G., Chen, Z., Sun, L., Fang, Q., Kuhn, R., Rao, V.B.
Deposition date:2024-12-26
PDBID:9mog
Status:HPUB -- hold until publication
Title:Structure of the distal part of the bacteriophage T4 tail
Authors:Fokine, A., Zhu, J., Klose, T., Vago, F., Arnaud, C., Wang, Z., Khare, B., Rossmann, M.G., Chen, Z., Sun, L., Fang, Q., Kuhn, R., Rao, V.B.
Deposition date:2024-12-26
PDBID:9hva
Status:HPUB -- hold until publication
Title:Crystal structure of Fab34 complexed with a 18-mer peptide of FMDV VP1
Authors:Ren, J., Duyvesteyn, H.M.E., Stuart, D.I.
Deposition date:2024-12-25
PDBID:9l75
Status:HOLD -- hold until a certain date
Title:A novel PE hydrolase and its structural basis
Authors:Wang, Y.S., Sun, D.Y., Jia, H.H., Sun, Y.Z., Qiu, L.N.
Deposition date:2024-12-25
Release date:2025-12-25
PDBID:9l6v
Status:HPUB -- hold until publication
Title:Cryo-EM structure of A. thaliana H2A.W nucleosome
Authors:Liu, X., Gong, Q.Y.
Deposition date:2024-12-25
PDBID:9hv3
Status:HPUB -- hold until publication
Title:Crystal structure of human GSK3b in complex with ARN25657
Authors:Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G.
Deposition date:2024-12-24
PDBID:9hv9
Status:HPUB -- hold until publication
Title:Crystal structure of Fab34 complexed with a 7-mer peptide of FMDV VP1
Authors:Ren, J., Duyvesteyn, H.M.E., Stuart, D.I.
Deposition date:2024-12-24
PDBID:9l63
Status:HPUB -- hold until publication
Title:A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures
Authors:Jiang, J., Fang, P.
Deposition date:2024-12-24
PDBID:9l64
Status:HPUB -- hold until publication
Title:A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures
Authors:Jiang, J., Fang, P.
Deposition date:2024-12-24
PDBID:9l65
Status:HPUB -- hold until publication
Title:A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures
Authors:Jiang, J., Fang, P.
Deposition date:2024-12-24
PDBID:9l6e
Status:HPUB -- hold until publication
Title:A novel allosteric covalent inhibitory site of fucosyltransferase 8 revealed by crystal structures
Authors:Jiang, J., Fang, P.
Deposition date:2024-12-24
PDBID:9l6m
Status:HPUB -- hold until publication
Title:Crystal Structure of BRD2 BD1 domain in complex with small molecule inhibitor Isoxazole azepine compound.
Authors:Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K.
Deposition date:2024-12-24
Sequence:

>Entity 1


MGSSHHHHHHSSGLVPRGSHMSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGA
PDBID:9l6p
Status:HPUB -- hold until publication
Title:Cryo-electron microscopic structure of a highly efficient ochratoxin detoxification enzyme LlADH
Authors:Dai, L.H., Xu, Y.H., Hu, Y.M., Niu, D., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Guo, R.-T., Chen, C.-C.
Deposition date:2024-12-24
PDBID:9mo3
Status:HPUB -- hold until publication
Title:LINE-1 Reverse Transcriptase bound to an incorporated inhibitor-terminated DNA primer RNA template duplex and dTTP as the incoming base
Authors:Nichols, C., Viacava Follis, A.
Deposition date:2024-12-24
PDBID:9mo1
Status:HPUB -- hold until publication
Title:LINE-1 Reverse Transcriptase bound to a DNA primer RNA template duplex and triphosphate nucleoside inhibitor as the incoming base
Authors:Nichols, C., Viacava Follis, A.
Deposition date:2024-12-24
PDBID:9huh
Status:HPUB -- hold until publication
Title:CryoEM structure of human peptidylarginine deiminase type 4 (PAD4) in 10 mM calcium
Authors:Bereta, G.P., Bielecka, E., Biela, A.P., Wilk, P., Wator-Wilk, E., Grudnik, P., Kantyka, T.
Deposition date:2024-12-23
PDBID:9hus
Status:HOLD -- hold until a certain date
Title:Structure of WT E.coli ribosome with complexed filament nascent chain at length 31, with P-site tRNAs
Authors:Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J.
Deposition date:2024-12-23
Release date:2025-12-23
PDBID:9huq
Status:HPUB -- hold until publication
Title:Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site tRNA
Authors:Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J.
Deposition date:2024-12-23
PDBID:9huk
Status:HPUB -- hold until publication
Title:Crystal structure of human GSK3b in complex with ARN24161
Authors:Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G.
Deposition date:2024-12-23

238895

PDB entries from 2025-07-16

PDB statisticsPDBj update infoContact PDBjnumon