| PDBID: | 9l36 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-electron microscopic structure of a novel amidohydrolase ADH3 triple mutation | | Authors: | Dai, L.H., He, B.Y., Hu, Y.M., Xu, Y.H., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-17 | | Release date: | 2026-06-17 |
|
| PDBID: | 9l2o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure and rational engineering of a novel efficient ochratoxin A-detoxifying amidohydrolase | | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-17 | | Release date: | 2026-06-17 |
|
| PDBID: | 9mka | | Status: | HPUB -- hold until publication | | Title: | Gallid alphaherpesvirus-1 large tegument protein NLS 1 in complex with Importin alpha | | Authors: | Nath, B.K., Swarbrick, C.M.D., Sarker, S., Forwood, J.K. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-57 | | Authors: | Shaw, J.M., Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of meropenem bound to OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of avibactam bound to OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqh | | Status: | HPUB -- hold until publication | | Title: | SARM1 TIR domain in complex with compound 28-ADPR | | Authors: | Giroud, M., Kuhn, B., Steiner, S., Westwood, P., Mendel, M., Mani, A., Pinard, E., Haap, W., Grether, U., Caramenti, P., Rombach, D., Zambaldo, C., Ritter, M., Schmid, P., Gasser, C., Aregger, N., Sechet, N., Topp, A., Bilyard, M., Malnight-Alvarez, A., Plitzko, I., Hilbert, M., Kalayil, S., Burger, D., Bonardi, C., Saal, W., Haider, A., Wittwer, M., Brigo, A., Keaney, J., Benz, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqf | | Status: | HPUB -- hold until publication | | Title: | SARM1 TIR domain in complex with compound 7-ADPR | | Authors: | Giroud, M., Kuhn, B., Steiner, S., Westwood, P., Mendel, M., Mani, A., Pinard, E., Haap, W., Grether, U., Caramenti, P., Rombach, D., Zambaldo, C., Ritter, M., Schmid, P., Gasser, C., Aregger, N., Sechet, N., Topp, A., Bilyard, M., Malnight-Alvarez, A., Plitzko, I., Hilbert, M., Kalayil, S., Burger, D., Bonardi, C., Saal, W., Haider, A., Wittwer, M., Brigo, A., Keaney, J., Benz, J. | | Deposition date: | 2024-12-16 | | Sequence: | >Entity 1
GGSSGSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQ
|
|
| PDBID: | 9hpo | | Status: | HPUB -- hold until publication | | Title: | Docedameric RuvBL1/RuvBL2 | | Authors: | Santo, P.E., Plisson-Chastang, C. | | Deposition date: | 2024-12-13 |
|
| PDBID: | 9mik | | Status: | HPUB -- hold until publication | | Title: | Gallid alphaherpesvirus-1 large tegument protein bipartite NLS2 in complex with Importin alpha | | Authors: | Nath, B.K., Swarbrick, C.M.D., Sarker, S., Forwood, J.K. | | Deposition date: | 2024-12-12 |
|
| PDBID: | 9ho1 | | Status: | HPUB -- hold until publication | | Title: | Room temperature structure of Aspartyl/Asparaginyl beta-hydroxylase (AspH) in complex with Fe, 2-oxoglutarate, and hydroxylated Factor X derived peptide fragment, 1.5 s O2 exposure | | Authors: | de Munnik, M., Rabe, P., Brewitz, L., Brasnett, A., Zhou, T., Schofield, C.J., Kern, J.F. | | Deposition date: | 2024-12-11 |
|
| PDBID: | 9ho3 | | Status: | HPUB -- hold until publication | | Title: | Aspartyl/Asparaginyl beta-hydroxylase (AspH) in complex with Fe, 2OG, nitric oxide, and Factor X peptide fragment | | Authors: | de Munnik, M., Rabe, P., Brasnett, A., Brewitz, L., Schofield, C.J. | | Deposition date: | 2024-12-11 |
|
| PDBID: | 9ho2 | | Status: | HPUB -- hold until publication | | Title: | Room temperature structure of Aspartyl/Asparaginyl beta-hydroxylase (AspH) in complex with Fe, 2-oxoglutarate and Factor X derived peptide fragment, excess Fe removed | | Authors: | de Munnik, M., Rabe, P., Brewitz, L., Brasnett, A., Zhou, T., Schofield, C.J., Kern, J.F. | | Deposition date: | 2024-12-11 |
|
| PDBID: | 9hnz | | Status: | HPUB -- hold until publication | | Title: | Room temperature structure of Aspartyl/Asparaginyl beta-hydroxylase (AspH) in complex with Fe, 2-oxoglutarate and hydroxylated Factor X derived peptide fragment, 2 h O2 exposure | | Authors: | de Munnik, M., Rabe, P., Brasnett, A., Brewitz, L., Schofield, C.J. | | Deposition date: | 2024-12-11 |
|
| PDBID: | 9mes | | Status: | HPUB -- hold until publication | | Title: | NMR strucuture of Dengue Virus 2 capsid protein with the deletion of the intrinsically disordered N-terminal region | | Authors: | Barbosa, G.M., Da Poian, A.T., Almeida, F.C.L. | | Deposition date: | 2024-12-08 |
|
| PDBID: | 9md7 | | Status: | HPUB -- hold until publication | | Title: | Hip1 complex with inhibitor #1 (Hip1-1) via Ser228 | | Authors: | Yim, M.K., Olsen, K.J., Brooks, C.L., Pena, K.J., Johnson, S.J., Goldfarb, N.E. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9md8 | | Status: | HPUB -- hold until publication | | Title: | Hip1 complex with inhibitor #2 (Hip1-2) via Ser228 | | Authors: | Yim, M.K., Schumann, N.C., Goldfarb, N.E., Johnson, S.J. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9kvw | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structures of Keap1-compound complexes | | Authors: | Zhuang, C.L., Yu, R.L. | | Deposition date: | 2024-12-05 | | Release date: | 2025-12-05 |
|
| PDBID: | 9kvo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation D132E | | Authors: | Liu, C. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9hkr | | Status: | HPUB -- hold until publication | | Title: | NMR structure of the C-terminal domain of the human SPAG1 protein | | Authors: | Chagot, M.E., Quinternet, M. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9kva | | Status: | HPUB -- hold until publication | | Title: | ECR CK PROTEIN | | Authors: | Kulakman, C., DeMirci, H., Wakatsuki, S., Mathews, I. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9kuu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation D130G | | Authors: | Liu, C. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9kv1 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation E141G | | Authors: | Liu, C. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9kvb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin | | Authors: | Liu, C. | | Deposition date: | 2024-12-04 |
|
