| PDBID: | 9jc4 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-G51DA53T P2 a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9jc5 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-G51DA53T P3 a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9jc3 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-G51DA53T P1 a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de0 | | Status: | HOLD -- hold until a certain date | | Title: | The Cryo-EM structure of a complex between GAD65 and b96.11 Fab | | Authors: | Reboul, C.F., Le, S.N., Williams, D.E., Buckle, A.M. | | Deposition date: | 2024-08-28 | | Release date: | 2025-08-28 |
|
| PDBID: | 9de3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 complexed with compound 28 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Q108K:K40L:T51V:T53C:R58Y:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V in the dark at pH 6.0 | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9jc0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Multidrug resistance-associated protein 2 in complex with SN38G | | Authors: | Yun, C.H., Zhao, P. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jbw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of Ac-K58D_G51DA53T a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9jby | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-K58W_G51DA53T a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9dcr | | Status: | HPUB -- hold until publication | | Title: | Structure of the TelA-associated type VII secretion system chaperone SIR_0168 | | Authors: | Gkragkopoulou, P., Kim, Y., Whitney, J.C. | | Deposition date: | 2024-08-27 |
|
| PDBID: | 9glf | | Status: | HOLD -- hold until a certain date | | Title: | Anthraquinone Pigment Production Regulated by Cinnamic Acid | | Authors: | Su, L., Schmalhofer, M., Grammbitter, G.L.C., Paczia, N., Glatter, T., Groll, M., Bode, H.B. | | Deposition date: | 2024-08-27 | | Release date: | 2025-08-27 | | Sequence: | >Entity 1
GSSHHHHHHSGDPASMNNKNKPNRISPELLATCGYFMPRIFFLNSQYAPQVHWGDVVAALSHFPAGNLDLSSEEFWYEWMINWSKVGDSYINIANSAKSEVSHVRALRSAAACYHWAEFMYFSDRSRKIQLREYIRSCFLSSIKYSDLLVDHQYIVVDKFHMPFFLIFPKGYKEEENHPLPCVILSNGLDSMTEIEILSLAEFFLGKNMAVAIFDGPGQGINLGKSPIAIDMELYVSSIVKLLEDDARINSNLLCFLGISFGGYFALRVAQRIGDKFCCIVNLSGGPEIAEFDKLPRRLKEDFQFAFMQDNSHMQSIFDEIKLDISLPCKTKVFTVHGELDDIFQIDKVKKLDQLWGDNHQLLCYESEAHVCLNKINEYMIQVSDWVSEQFWLNGYKKG
|
|
| PDBID: | 9jb3 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of DH domain of human FGD6 | | Authors: | Liu, Z.C., Chuan, J.L., Wang, G.G. | | Deposition date: | 2024-08-26 | | Release date: | 2025-08-26 |
|
| PDBID: | 9dc1 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Asymmetric unit of the inner core structure associated with portal in bacteriophage T7 | | Authors: | wang, C., Molineux, I.J., Liu, J. | | Deposition date: | 2024-08-25 |
|
| PDBID: | 9gko | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of 6mer pore intermediate of Sticholysin II (StnII) toxin in lipid nanodiscs | | Authors: | Martin Benito, J., Santiago, C., Carlero, D., Arranz, R. | | Deposition date: | 2024-08-25 | | Release date: | 2025-08-25 |
|
| PDBID: | 9gki | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of 5mer pore intermediate of Sticholysin II (StnII) toxin in lipid nanodiscs | | Authors: | Martin Benito, J., Santiago, C., Carlero, D. | | Deposition date: | 2024-08-25 | | Release date: | 2025-08-25 |
|
| PDBID: | 9gkk | | Status: | HPUB -- hold until publication | | Title: | BetP heterotrimeric complex | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2024-08-25 |
|
| PDBID: | 9gkj | | Status: | HPUB -- hold until publication | | Title: | Human TPC2 in Complex with Agonist and Metal Ion | | Authors: | Specht, T., Mayer, B., Fu, L., Urbansky, K., Madej, M.G., Ziegler, C. | | Deposition date: | 2024-08-25 |
|
| PDBID: | 9gkl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the octameric pore of Fragaceotxin C (FraC or DELTA-actitoxin-Afr1a) in large unilamellar vesicles. | | Authors: | Martin Benito, J., Santiago, C., Carlero, D., Arranz, R. | | Deposition date: | 2024-08-25 | | Release date: | 2025-08-25 |
|
| PDBID: | 9gkp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of fragacetoxin C in lipid nanodiscs | | Authors: | Martin Benito, J., Santiago, C., Arranz, R. | | Deposition date: | 2024-08-25 | | Release date: | 2025-08-25 |
|
| PDBID: | 9db7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 complexed with compound 21 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkf | | Status: | HPUB -- hold until publication | | Title: | Amyloid Fibril of Heterogeneous nuclear ribonucleoprotein A1A induced by RNA binding | | Authors: | Frey, L., Riek, R.P., Arosio, P., Morelli, C. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gjy | | Status: | HPUB -- hold until publication | | Title: | Bacillus licheniformis nitroreductase | | Authors: | Crennell, S.J., Danson, M.J., Emptage, C. | | Deposition date: | 2024-08-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSPSSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVADQLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAAALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQIVKWVE
|
|
| PDBID: | 9gjx | | Status: | HPUB -- hold until publication | | Title: | Bacillus licheniformis nitroreductase | | Authors: | Crennell, S.J., Danson, M.J., Emptage, C. | | Deposition date: | 2024-08-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSPSSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVADQLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAAALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQIVKWVE
|
|
| PDBID: | 9day | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the Transcriptional Regulator HcpR from Porphyromonas Gingivalis | | Authors: | Musayev, F.N., Escalante, C.R., Belvin, B.R., Lewis, J.P. | | Deposition date: | 2024-08-22 | | Sequence: | >Entity 1
MDHHHHHHENLYFQGSPEFDLLLKAWKSSGLSVGMKDDELLALLESCSYRVERLKAEELYAIGGDKLQDLRIVGVGEIRAEMVGPSGKQILIDTLAVGRILAPALLFASENILPVTLFANEDSVLFRIGKEEFKGMMHKYPTLMENFIGMISDISAFLMKKIHQLSLRSLQGKIGDYLFQLYTKDGSNRIVVESSWKELSDRFGVNRQSLARSLSQLEEEGIIRVDGKSIEILQPNRLSRLE
|
|
| PDBID: | 9dag | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 complexed with compound 12 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-22 |
|
