Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9otl
Status:HPUB -- hold until publication
Title:Crystal Structure of Salmonella FraB Deglycase, Crystal Form 1
Authors:Bell, C.E., Zakharova, K.
Deposition date:2025-05-27
PDBID:9otr
Status:HPUB -- hold until publication
Title:Crystal Structure of Salmonella FraB Deglycase, Crystal Form 4 with deletion of C-terminal residues 313-325.
Authors:Bell, C.E., Zakharova, K.
Deposition date:2025-05-27
PDBID:9otu
Status:HPUB -- hold until publication
Title:Crystal Structure of Salmonella FraB Deglycase, E214A Mutant, Crystal Form 5
Authors:Bell, C.E., Zakharova, K.
Deposition date:2025-05-27
Sequence:

>Entity 1


MDHHHHHHENLYFQMEPEESMMGMKETVSNIVTSQAEKGGVKHVYYVACGGSYAAFYPAKAFLEKEAKALTVGLYNSGEFINNPPVALGENAVVVVASHKGNTPETIKAAEIARQHGAPVIGLTWIMDSPLVAHCDYVETYTFGDGKDIAGEKTMKGLLSAVELLQQTEGYAHYDDFQDGVSKINRIVWRACEQVAERAQAFAQEYKDDKVIYTVASGAGYGAAYLQSICIFMAMQWIHSACIHSGEFFHGPFEITDANTPFFFQFSEGNTRAVDERALNFLKKYGRRIEVVDAAALGLSTIKTTVIDYFNHSLFNNVYPVYNRALAEARQHPLTTRRYMWKVEY
PDBID:9rbs
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of DENV3 NS2B-NS3 protease in complex with compound IRBM-D-1
Authors:Ontoria, J.M., Torrente, E.
Deposition date:2025-05-27
PDBID:9rbu
Status:HPUB -- hold until publication
Title:Cryo-ET structure of full-length membrane-bound EHD2 complex
Authors:Vazquez-Sarandeses, E., Mikirtumov, V., Noel, J., Kudryashev, M., Daumke, O.
Deposition date:2025-05-27
PDBID:9rc1
Status:HPUB -- hold until publication
Title:Cryo-ET structure of N-terminally truncated membrane-bound EHD2 complex
Authors:Vazquez-Sarandeses, E., Mikirtumov, V., Noel, J., Kudryashev, M., Daumke, O.
Deposition date:2025-05-27
PDBID:9ot6
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the PI4KA complex bound to an EFR3 interfering nanobody (F3IN)
Authors:Shaw, A.L., Suresh, S., Yip, C.K., Burke, J.E.
Deposition date:2025-05-26
PDBID:9osy
Status:HPUB -- hold until publication
Title:Tetrameric POLQ Helicase-like Domain Bound to Cmpd 36, a Small-Molecule ATPase Inhibitor and Drug Candidate Analog
Authors:Zahn, K.E., Mader, P., Sicheri, F.
Deposition date:2025-05-26
PDBID:9osw
Status:HPUB -- hold until publication
Title:Tetrameric POLQ Helicase-like Domain Bound to Cmpd 20, a Small-Molecule ATPase Inhibitor and Drug Candidate Analog
Authors:Zahn, K.E., Mader, P., Sicheri, F.
Deposition date:2025-05-26
PDBID:9v4e
Status:HPUB -- hold until publication
Title:Crystal Structure of Gallus gallus c-Src Kinase Domain with Point mutation Y416D and Deletion of Residues N414, T417, and R419 Bound to AMP-PNP
Authors:Jain, P., Clifton, B.E., Laurino, P.
Deposition date:2025-05-23
PDBID:9os7
Status:AUTH -- processed, waiting for author review and approval
Title:Mycoplasma penetrans Methionyl tRNA Synthetase is an Asymmetric Dimer fused to N-terminal Ancillary Domains
Authors:Ghazi Esfahani, B., Bowman, M., Alexander, R., Stroupe, M.E.
Deposition date:2025-05-23
PDBID:9oro
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of ProGH158 soaked with laminaritetraose at 1.31 angstrom resolution
Authors:Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T.
Deposition date:2025-05-22
PDBID:9rbf
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of a stalled E. coli 70S RNC-NuoK-86 in complex with the membrane protein insertase SecYEG-YidC
Authors:Rosales-Hernandez, C., Busch, M., Kamel, M., Beckmann, R., Kedrov, A.
Deposition date:2025-05-22
PDBID:9rbe
Status:HPUB -- hold until publication
Title:Crystal structure of a computationally designed protein bound to a gold cofactor (TRP_F43W.[sulfaNHC)Au])
Authors:Morris, E.F., Ward, T.R.
Deposition date:2025-05-22
PDBID:9v3d
Status:HPUB -- hold until publication
Title:SFX structure of 3-5 micrometers Lysozyme microcrystals
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3h
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 2 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3i
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 5 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3j
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 9.7 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3g
Status:HPUB -- hold until publication
Title:SFX structure of 1 micrometer Lysozyme microcrystals
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3k
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 1.3 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3l
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 5.0 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3m
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 7.5 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3n
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 9.7 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3o
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 452 mM N-Acetyl-D-glucosamine at 1.3 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21
PDBID:9v3p
Status:HPUB -- hold until publication
Title:Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 452 mM N-Acetyl-D-glucosamine at 2.5 seconds delay
Authors:Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E.
Deposition date:2025-05-21

238582

PDB entries from 2025-07-09

PDB statisticsPDBj update infoContact PDBjnumon