PDBID: | 9otl | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Salmonella FraB Deglycase, Crystal Form 1 | Authors: | Bell, C.E., Zakharova, K. | Deposition date: | 2025-05-27 |
|
PDBID: | 9otr | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Salmonella FraB Deglycase, Crystal Form 4 with deletion of C-terminal residues 313-325. | Authors: | Bell, C.E., Zakharova, K. | Deposition date: | 2025-05-27 |
|
PDBID: | 9otu | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Salmonella FraB Deglycase, E214A Mutant, Crystal Form 5 | Authors: | Bell, C.E., Zakharova, K. | Deposition date: | 2025-05-27 | Sequence: | >Entity 1 MDHHHHHHENLYFQMEPEESMMGMKETVSNIVTSQAEKGGVKHVYYVACGGSYAAFYPAKAFLEKEAKALTVGLYNSGEFINNPPVALGENAVVVVASHKGNTPETIKAAEIARQHGAPVIGLTWIMDSPLVAHCDYVETYTFGDGKDIAGEKTMKGLLSAVELLQQTEGYAHYDDFQDGVSKINRIVWRACEQVAERAQAFAQEYKDDKVIYTVASGAGYGAAYLQSICIFMAMQWIHSACIHSGEFFHGPFEITDANTPFFFQFSEGNTRAVDERALNFLKKYGRRIEVVDAAALGLSTIKTTVIDYFNHSLFNNVYPVYNRALAEARQHPLTTRRYMWKVEY
|
|
PDBID: | 9rbs | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of DENV3 NS2B-NS3 protease in complex with compound IRBM-D-1 | Authors: | Ontoria, J.M., Torrente, E. | Deposition date: | 2025-05-27 |
|
PDBID: | 9rbu | Status: | HPUB -- hold until publication | Title: | Cryo-ET structure of full-length membrane-bound EHD2 complex | Authors: | Vazquez-Sarandeses, E., Mikirtumov, V., Noel, J., Kudryashev, M., Daumke, O. | Deposition date: | 2025-05-27 |
|
PDBID: | 9rc1 | Status: | HPUB -- hold until publication | Title: | Cryo-ET structure of N-terminally truncated membrane-bound EHD2 complex | Authors: | Vazquez-Sarandeses, E., Mikirtumov, V., Noel, J., Kudryashev, M., Daumke, O. | Deposition date: | 2025-05-27 |
|
PDBID: | 9ot6 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the PI4KA complex bound to an EFR3 interfering nanobody (F3IN) | Authors: | Shaw, A.L., Suresh, S., Yip, C.K., Burke, J.E. | Deposition date: | 2025-05-26 |
|
PDBID: | 9osy | Status: | HPUB -- hold until publication | Title: | Tetrameric POLQ Helicase-like Domain Bound to Cmpd 36, a Small-Molecule ATPase Inhibitor and Drug Candidate Analog | Authors: | Zahn, K.E., Mader, P., Sicheri, F. | Deposition date: | 2025-05-26 |
|
PDBID: | 9osw | Status: | HPUB -- hold until publication | Title: | Tetrameric POLQ Helicase-like Domain Bound to Cmpd 20, a Small-Molecule ATPase Inhibitor and Drug Candidate Analog | Authors: | Zahn, K.E., Mader, P., Sicheri, F. | Deposition date: | 2025-05-26 |
|
PDBID: | 9v4e | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Gallus gallus c-Src Kinase Domain with Point mutation Y416D and Deletion of Residues N414, T417, and R419 Bound to AMP-PNP | Authors: | Jain, P., Clifton, B.E., Laurino, P. | Deposition date: | 2025-05-23 |
|
PDBID: | 9os7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Mycoplasma penetrans Methionyl tRNA Synthetase is an Asymmetric Dimer fused to N-terminal Ancillary Domains | Authors: | Ghazi Esfahani, B., Bowman, M., Alexander, R., Stroupe, M.E. | Deposition date: | 2025-05-23 |
|
PDBID: | 9oro | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ProGH158 soaked with laminaritetraose at 1.31 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-05-22 |
|
PDBID: | 9rbf | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of a stalled E. coli 70S RNC-NuoK-86 in complex with the membrane protein insertase SecYEG-YidC | Authors: | Rosales-Hernandez, C., Busch, M., Kamel, M., Beckmann, R., Kedrov, A. | Deposition date: | 2025-05-22 |
|
PDBID: | 9rbe | Status: | HPUB -- hold until publication | Title: | Crystal structure of a computationally designed protein bound to a gold cofactor (TRP_F43W.[sulfaNHC)Au]) | Authors: | Morris, E.F., Ward, T.R. | Deposition date: | 2025-05-22 |
|
PDBID: | 9v3d | Status: | HPUB -- hold until publication | Title: | SFX structure of 3-5 micrometers Lysozyme microcrystals | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v3h | Status: | HPUB -- hold until publication | Title: | Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 2 seconds delay | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v3i | Status: | HPUB -- hold until publication | Title: | Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 5 seconds delay | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v3j | Status: | HPUB -- hold until publication | Title: | Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 9.7 seconds delay | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v3g | Status: | HPUB -- hold until publication | Title: | SFX structure of 1 micrometer Lysozyme microcrystals | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v3k | Status: | HPUB -- hold until publication | Title: | Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 1.3 seconds delay | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v3l | Status: | HPUB -- hold until publication | Title: | Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 5.0 seconds delay | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v3m | Status: | HPUB -- hold until publication | Title: | Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 7.5 seconds delay | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v3n | Status: | HPUB -- hold until publication | Title: | Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 9.7 seconds delay | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v3o | Status: | HPUB -- hold until publication | Title: | Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 452 mM N-Acetyl-D-glucosamine at 1.3 seconds delay | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | Deposition date: | 2025-05-21 |
|
PDBID: | 9v3p | Status: | HPUB -- hold until publication | Title: | Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 452 mM N-Acetyl-D-glucosamine at 2.5 seconds delay | Authors: | Luo, F., Kang, J., Tono, K., Iwata, S., Nango, E. | Deposition date: | 2025-05-21 |
|