Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9md8
Status:HPUB -- hold until publication
Title:Hip1 complex with inhibitor #2 (Hip1-2) via Ser228
Authors:Yim, M.K., Schumann, N.C., Goldfarb, N.E., Johnson, S.J.
Deposition date:2024-12-05
PDBID:9kva
Status:HPUB -- hold until publication
Title:ECR CK PROTEIN
Authors:Kulakman, C., DeMirci, H., Wakatsuki, S., Mathews, I.
Deposition date:2024-12-04
PDBID:9kuu
Status:HPUB -- hold until publication
Title:Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation D130G
Authors:Liu, C.
Deposition date:2024-12-04
PDBID:9kv1
Status:HPUB -- hold until publication
Title:Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation E141G
Authors:Liu, C.
Deposition date:2024-12-04
PDBID:9kvb
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin
Authors:Liu, C.
Deposition date:2024-12-04
PDBID:9hkr
Status:HPUB -- hold until publication
Title:NMR structure of the C-terminal domain of the human SPAG1 protein
Authors:Chagot, M.E., Quinternet, M.
Deposition date:2024-12-04
PDBID:9ku7
Status:HPUB -- hold until publication
Title:complex structure of methyltransferases SMYD2 and inhibitor (17)
Authors:Sun, Y.L., Lu, J., Zhao, K.H., Lu, W.C.
Deposition date:2024-12-03
Sequence:

>Entity 1


GRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
PDBID:9ekp
Status:HPUB -- hold until publication
Title:Crystal structure of WDR55 in complex with XS381774
Authors:Chen, U.H., Li, F., Zeng, H., Ahmad, H., Wang, X., Sun, J., Dong, A., Seitova, A., Arrowsmith, C.H., Edwards, A.M., Peng, H., Halabelian, L., Structural Genomics Consortium (SGC)
Deposition date:2024-12-03
Sequence:

>Entity 1


SMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQEGETKELWSSGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDD
PDBID:9ekr
Status:HPUB -- hold until publication
Title:Human Hsp27 alpha-crystallin domain (84-171) R136W in complex with a peptide mimic of its C-terminus
Authors:Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A.
Deposition date:2024-12-03
PDBID:9el2
Status:HPUB -- hold until publication
Title:Human Hsp27 alpha-crystallin domain (84-171) T151I in complex with a peptide mimic of its C-terminus
Authors:Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A.
Deposition date:2024-12-03
PDBID:9el3
Status:HPUB -- hold until publication
Title:Human Hsp27 alpha-crystallin domain (84-171) T164A in complex with a peptide mimic of its C-terminus
Authors:Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A.
Deposition date:2024-12-03
PDBID:9hkm
Status:HPUB -- hold until publication
Title:Transient activated state of BetP-M150E
Authors:Urbansky, K., Gauthier-Manuel, L., Fu, L., Madej, M.G., Ziegler, C.
Deposition date:2024-12-03
PDBID:9hkl
Status:HPUB -- hold until publication
Title:BetP-M150E in complex with GABA in an inward-facing state
Authors:Urbansky, K., Fu, L., Madej, M.G., Ziegler, C.
Deposition date:2024-12-03
PDBID:9hko
Status:HPUB -- hold until publication
Title:Downregulated closed state of BetP in complex with betaine
Authors:Urbansky, K., Fu, L., Madej, M.G., Ziegler, C.
Deposition date:2024-12-03
PDBID:9ktq
Status:HPUB -- hold until publication
Title:Crystal structure of the pathogen-secreted apoplastic GH12 xyloglucan-specific endoglucanase XEG1
Authors:Xia, Y.Q., Liu, L., Zhang, Q., Shi, X.C., Wang, Z.K., Zhang, Z.C., He, X.Y., Xiao, J.H., Jiang, H.B., Zhang, S.C., Yang, Y.H., Ye, W.W., Wang, Z.Y., Wang, Y., Ma, Z.C., Yang, Q., Wang, Y.C.
Deposition date:2024-12-02
PDBID:9ktn
Status:HPUB -- hold until publication
Title:The crystal structure of SARS-CoV-2 nsp10-nsp16 methyltransferase complex with MI54
Authors:Cao, L., Xu, T.F., Yan, L.M., Yang, S.D., Zhang, H.W., Ji, Y.X., Ge, J., Fan, S.L., Li, C.M., Rao, Z.H., Lou, Z.Y., Guo, D.Y.
Deposition date:2024-12-02
PDBID:9ekj
Status:HPUB -- hold until publication
Title:Crystal structure of the mutant (R140Q) IDH2 homodimer in complex with clonixin
Authors:Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M.
Deposition date:2024-12-02
PDBID:9ekl
Status:HPUB -- hold until publication
Title:Crystal structure of the Michaelis complex of the mutant (R140Q, I319M) IDH2 homodimer
Authors:Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M.
Deposition date:2024-12-02
PDBID:9eka
Status:AUTH -- processed, waiting for author review and approval
Title:CRISPR-associated deaminase Cad1 in Apo form
Authors:Zhao, Y., Whyms, C.T., Li, H.
Deposition date:2024-12-02
PDBID:9ek9
Status:HPUB -- hold until publication
Title:CryoEM structure of the mutant (R140Q) IDH2 homodimer
Authors:Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M.
Deposition date:2024-12-02
PDBID:9eki
Status:HPUB -- hold until publication
Title:Crystal structure of the Michaelis complex of the mutant (R140Q) IDH2 homodimer
Authors:Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M.
Deposition date:2024-12-02
PDBID:9kt4
Status:HPUB -- hold until publication
Title:complex structure of methyltransferases SMYD2 and inhibitor (003)
Authors:Lu, J., Sun, Y.L., Lu, W.C., Cao, L.H., Liu, Y.H.
Deposition date:2024-12-01
PDBID:9ksc
Status:AUTH -- processed, waiting for author review and approval
Title:RfaH-mediated transcription-coupled translation pre-initiation complexes (state 1), with 44-mer mRNA, RfaH, fMet-tRNA(fMet), IF-1, IF-2, IF-3.
Authors:Lu, G., Zhang, J., Wang, C., Lin, J.
Deposition date:2024-11-29
PDBID:9ksf
Status:AUTH -- processed, waiting for author review and approval
Title:RfaH-mediated transcription-coupled translation pre-initiation complexes (state 2), with 56-mer mRNA, RfaH, NusA, fMet-tRNA(fMet), IF-1, IF-2, IF-3.
Authors:Lu, G., Zhang, J., Wang, C., Lin, J.
Deposition date:2024-11-29
PDBID:9kse
Status:AUTH -- processed, waiting for author review and approval
Title:RfaH-mediated transcription-coupled translation pre-initiation complexes (state 3), with 32-mer mRNA, RfaH, fMet-tRNA(fMet), IF-1, IF-2, IF-3.
Authors:Lu, G., Zhang, J., Wang, C., Lin, J.
Deposition date:2024-11-29

242842

PDB entries from 2025-10-08

PDB statisticsPDBj update infoContact PDBjnumon