| PDBID: | 9v8o | | Status: | HPUB -- hold until publication | | Title: | Influenza A(H5N6) virus polymerase symmetric dimer in post-termination state with bound vRNA promoter | | Authors: | Wang, A.J., Liao, M. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ovf | | Status: | HPUB -- hold until publication | | Title: | Rubredoxin covalently linked to benzo-18-crown-6 | | Authors: | Adhami, N., Sawaya, M.R., Shafaat, H.S., Rodriguez, J.A., Spokoyny, A.M. | | Deposition date: | 2025-05-29 | | Sequence: | >Entity 1 MQKYVCNVCGYEYDPAEHDNVPFDQLPDDWCCPVCGVSKDQFSPA
|
|
| PDBID: | 9ou2 | | Status: | HPUB -- hold until publication | | Title: | K-Ras Wild Type 1-169 Bound to BI-2865 at 100 K | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Cerione, R.A. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9oua | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Netrin-1 (NET1) in complex with UNC5B | | Authors: | Rafiei, F., Gupta, M., Bailey-Elkin, B.A., Koch, M., Stetefeld, J. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9ou8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hUGDH Dimer-A104L/A136M complexed with UDP-Xyl | | Authors: | Kadirvelraj, R., Wood, Z.A. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9ou3 | | Status: | HPUB -- hold until publication | | Title: | K-Ras Wild Type 1-169 bound to BI-2865 at 293K | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Cerione, R.A. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9ouh | | Status: | HPUB -- hold until publication | | Title: | K-Ras G12D Cysteine Light at 293 K | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Cerione, R.A. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9oui | | Status: | HPUB -- hold until publication | | Title: | K-Ras G12D 1-169 bound to MRTX-1133 at 313 K | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Cerione, R.A. | | Deposition date: | 2025-05-28 |
|
| PDBID: | 9rbx | | Status: | HPUB -- hold until publication | | Title: | LhiA-HdpA protein complex | | Authors: | Mechaly, A., Danot, O., Haouz, A., Gomperts Boneca, I. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9rbo | | Status: | HPUB -- hold until publication | | Title: | A cryo-EM structure of native C3 protein in a compact conformation. | | Authors: | Whittaker, J.J., Eikrem, D., Seisenbaeva, G., Nilsson-Ekdahl, K., Nilsson, B., Sandgren, M., Kessler, V.G. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9rca | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of the lipoyl domain of the E2 subunit in the human alpha-ketoglutarate dehydrogenase complex | | Authors: | Czajlik, A., Batta, G., Ambrus, A. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9rby | | Status: | HOLD -- hold until a certain date | | Title: | LhiA-HdpA fusion protein | | Authors: | Mechaly, A., Danot, O., Haouz, A., Gomperts Boneca, I. | | Deposition date: | 2025-05-27 | | Release date: | 2026-05-27 |
|
| PDBID: | 9otz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C virus envelope glycoprotein HCV-1 E2ecto from genotype 1a bound to neutralizing antibody K568 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9oth | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | D3 prohead 1 | | Authors: | Belford, A.K., Huet, A., Maurer, J.B., Duda, R.L., Conway, J.F. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9v69 | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of the two-electron reduced form of wild type b5R | | Authors: | Hirano, Y., Kurihara, K., Kusaka, K., Ostermann, A., Hikita, M., Kimura, S., Miki, K., Tamada, T. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9v6a | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of the T66V mutant b5R co-crystallized with NADH | | Authors: | Hirano, Y., Kurihara, K., Kusaka, K., Ostermann, A., Hikita, M., Kimura, S., Miki, K., Tamada, T. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9v6b | | Status: | HPUB -- hold until publication | | Title: | Neutron crystal structure of the oxidized form of b5R at pD 6.5 | | Authors: | Hirano, Y., Kurihara, K., Kusaka, K., Ostermann, A., Hikita, M., Kimura, S., Miki, K., Tamada, T. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9v6c | | Status: | HPUB -- hold until publication | | Title: | Neutron crystal structure of the oxidized form of b5R at pD 7.5 | | Authors: | Hirano, Y., Kurihara, K., Kusaka, K., Ostermann, A., Hikita, M., Kimura, S., Miki, K., Tamada, T. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9v77 | | Status: | HPUB -- hold until publication | | Title: | Insights into a Versatile PET-degrading Enzyme TmFae-PETase : From Molecular Mechanism to Practical Applications | | Authors: | Hou, X.X., Hou, X.X. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9v6f | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of a ThDP-dependent enzyme PpBFD | | Authors: | Hou, X.L., Zhou, J.H. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9v6m | | Status: | HPUB -- hold until publication | | Title: | Insights into a Versatile PET-degrading Enzyme TmFae-PETase : From Molecular Mechanism to Practical Applications | | Authors: | Hou, X.X., Hou, X.X. | | Deposition date: | 2025-05-27 |
|
| PDBID: | 9ot6 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the PI4KA complex bound to an EFR3 interfering nanobody (F3IN) | | Authors: | Shaw, A.L., Suresh, S., Yip, C.K., Burke, J.E. | | Deposition date: | 2025-05-26 |
|
| PDBID: | 9ot7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C virus envelope glycoprotein Hk6a E2c3 from genotype 6a bound to human neutralizing antibody K509 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-05-26 |
|
| PDBID: | 9ot4 | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 Main Protease (Mpro) in Complex with Covalent Inhibitor E9 | | Authors: | Mazzorana, M., Oliveira Borges, P.H., Silva-Junior, F., Baptista Ferreira, S., Walsh, M.A. | | Deposition date: | 2025-05-26 | | Release date: | 2026-05-26 |
|
| PDBID: | 9v62 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryogenic temprature crystal structure of Escherichia coli CyaY | | Authors: | Shafiei, A., DeMirci, H. | | Deposition date: | 2025-05-26 |
|