Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9qn5
Status:HPUB -- hold until publication
Title:Crystal structure of human SUMO E1 with small unit cell parameters in the P1 21 1 space group.
Authors:Viloria, M., Francois, R.M.M., Didierjean, C.
Deposition date:2025-03-24
PDBID:7i90
Status:HPUB -- hold until publication
Title:Crystal Structure of 7 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i91
Status:HPUB -- hold until publication
Title:Crystal Structure of 13 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:7i9f
Status:HPUB -- hold until publication
Title:Crystal Structure of 16 bound to the ph domain of Btk
Authors:Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M.
Deposition date:2025-03-24
PDBID:9u6r
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the Vo domain of V/A-ATPase in liposomes under no pmf condition,state2
Authors:Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K.
Deposition date:2025-03-23
PDBID:9u6s
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the Vo domain of V/A-ATPase in liposomes under no pmf condition,state3
Authors:Nakano, A., Kishikawa, J., Nishida, Y., Shigematsu, H., Gerle, C., Mitsuoka, M., Yokoyama, K.
Deposition date:2025-03-23
PDBID:9u5y
Status:HPUB -- hold until publication
Title:Crystal structure of cytochrome P450 mutant-T288G S289Q G290E T291I of CYP161H12 from Amycolatopsis pretoriensis
Authors:Dong, L.B., Zhang, X.W., Wang, Y.X., Pan, X.M., Liu, C.H.
Deposition date:2025-03-22
PDBID:9qmd
Status:HPUB -- hold until publication
Title:Crystal Structure of Dimeric Apo-L28H-FNR of A. Fischeri
Authors:Volbeda, A., Fontecilla-Camps, J.C., Rohac, R.
Deposition date:2025-03-22
PDBID:9qlz
Status:HPUB -- hold until publication
Title:Crystal structure of a [2Fe-2S] form of D4A-FNR of A. fischeri
Authors:Volbeda, A., Fontecilla-Camps, J.C., Rohac, R.
Deposition date:2025-03-21
PDBID:9qlj
Status:HPUB -- hold until publication
Title:Crystal Structure of a Disordered Apo-form of A. Fischeri FNR
Authors:Volbeda, A., Fontecilla-Camps, J.C., Rohac, R.
Deposition date:2025-03-21
PDBID:9qll
Status:HPUB -- hold until publication
Title:Crystal structure of holo-D4A-FNR of A. fischeri
Authors:Volbeda, A., Fontecilla-Camps, J.C., Rohac, R.
Deposition date:2025-03-21
PDBID:9qlt
Status:HPUB -- hold until publication
Title:Crystal Structure of Dimeric Apo-D154A-FNR of A. Fischeri
Authors:Volbeda, A., Fontecilla-Camps, J.C.
Deposition date:2025-03-21
PDBID:9qly
Status:HPUB -- hold until publication
Title:Crystal structure of holo-D130A-FNR of A. fischeri
Authors:Volbeda, A., Fontecilla-Camps, J.C., Rohac, R.
Deposition date:2025-03-21
PDBID:9u52
Status:HPUB -- hold until publication
Title:NMR Solution Structures of CX-5461-MYT1L Complex
Authors:Li, Y., Cao, C.
Deposition date:2025-03-20
PDBID:9nvb
Status:HPUB -- hold until publication
Title:Co-crystal structure of human SMYD1 in complex with MYH2 peptide and SAH
Authors:Zeng, H., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC)
Deposition date:2025-03-20
PDBID:9ql0
Status:HOLD -- hold until a certain date
Title:E. coli IspH crystallized in the presence of adenosine hemisulfate
Authors:Bikbaev, K., Dormann, C., Span, I.
Deposition date:2025-03-20
Release date:2026-03-20
PDBID:9qkq
Status:HPUB -- hold until publication
Title:Crystal structure of hTEAD4 YAP binding domain (hTEAD4-YBD) in complex with peptide 6
Authors:Pozzi, C.
Deposition date:2025-03-20
Sequence:

>Entity 1


GSHMRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

>Entity 2


(ACE)P(6CW)RLRK(NLE)PDSF(ALN)KPP(NH2)
PDBID:9u4p
Status:HOLD -- hold until a certain date
Title:Human Keratin 19 tail domain Q387-L400 in solution
Authors:Ji, Y., Jeong, M., Kim, J., Lee, C.H.
Deposition date:2025-03-19
Release date:2026-03-19
Sequence:

>Entity 1


QEDHYNNLSASKVL
PDBID:9u4q
Status:HOLD -- hold until a certain date
Title:Human Keratin 19 tail domain Q387-L400 in 30% 2,2,2-trifluoroethanol
Authors:Ji, Y., Jeong, M., Kim, J., Lee, C.H.
Deposition date:2025-03-19
Release date:2026-03-19
Sequence:

>Entity 1


QEDHYNNLSASKVL
PDBID:9u4h
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the catalytic domain of human PDE3A bound to Ensifentrine
Authors:Wu, C.Y., Wang, Y.X.
Deposition date:2025-03-19
PDBID:9u33
Status:HPUB -- hold until publication
Title:D14.F25.S02 Fab complexed to DENV2-US/BID/V594/2006 virus - 5f-3f Fab map
Authors:Chatterjee, A.C., Mangala Prasad, V.
Deposition date:2025-03-18
PDBID:9q8c
Status:HPUB -- hold until publication
Title:Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment F02
Authors:Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K.
Deposition date:2025-03-18
PDBID:9mc2
Status:HOLD -- hold until a certain date
Title:Cryo-EM structure of dopaminated Tau fibril
Authors:Liu, Z., Li, X., Liu, C.
Deposition date:2025-03-17
Release date:2026-03-17
PDBID:9qi9
Status:HPUB -- hold until publication
Title:Crystal structure of styrene monooxygenase RhStyA
Authors:Levy, C.W., Ortmayer, M.
Deposition date:2025-03-17
PDBID:9mb8
Status:HPUB -- hold until publication
Title:the complex of D14 and RGSV P3
Authors:Huang, Y.C.
Deposition date:2025-03-15

245663

PDB entries from 2025-12-03

PDB statisticsPDBj update infoContact PDBjnumon