PDBID: | 9ifq | Status: | HPUB -- hold until publication | Title: | Unspecific peroxygenase from Psathyrella aberdarensis (PabUPO-II) in complex with 5-hydroxymethylfurfural | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ife | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z943693514 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9iff | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2856434836 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifg | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2204875953 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifc | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Autoinhibited PhiC31 integrase dimer on attL sites | Authors: | Spagnolo, L., Sun, Y.E., Joseph, A.P. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifn | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z436190540 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ift | Status: | HPUB -- hold until publication | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ | Authors: | Cecchini, D., Mattevi, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifu | Status: | HPUB -- hold until publication | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ and compound 1 | Authors: | Cecchini, D., Mattevi, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifw | Status: | HPUB -- hold until publication | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ and compound 4 | Authors: | Cecchini, D., Mattevi, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ify | Status: | HPUB -- hold until publication | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ and coenzyme Q1 | Authors: | Cecchini, D., Mattevi, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifh | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2856434890 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifi | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z32399802 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifj | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2017861827 | Authors: | Exertier, C., Fiorillo, A., Ilari, A., Antonelli, L. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifl | Status: | HPUB -- hold until publication | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z319545618 | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ifz | Status: | HPUB -- hold until publication | Title: | FSP1 (tetrapod ancestor) bound to FAD | Authors: | Cecchini, D., Mattevi, A. | Deposition date: | 2025-02-18 |
|
PDBID: | 9ncs | Status: | HPUB -- hold until publication | Title: | RNase A in complex with Uridine Vanadate and decavanadates | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | Deposition date: | 2025-02-17 | Sequence: | >Entity 1 KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
|
|
PDBID: | 9if2 | Status: | HPUB -- hold until publication | Title: | ZnT1 CTD regulation | Authors: | Ben-Yosef, T.E., Zarivach, R., Shahar, A. | Deposition date: | 2025-02-17 |
|
PDBID: | 9if1 | Status: | HPUB -- hold until publication | Title: | Unliganded structure of RNA duplex containing UGGAA/UGGAA motif | Authors: | Mateja-Pluta, M., Kiliszek, A. | Deposition date: | 2025-02-17 |
|
PDBID: | 9if3 | Status: | HPUB -- hold until publication | Title: | Structure of YIUA from Yersinia ruckeri with Iron and DHB-L-Arg-L-Ser | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | Deposition date: | 2025-02-17 |
|
PDBID: | 9nck | Status: | HPUB -- hold until publication | Title: | Nanotube of computationally designed peptide assembly R3K (16 protofilament) | Authors: | Das, A., Conticello, V. | Deposition date: | 2025-02-16 |
|
PDBID: | 9nce | Status: | HPUB -- hold until publication | Title: | Oxidized Treponema pallidum thioredoxin strain Nichols | Authors: | Carbone, V., Ronimus, R.S., Sutherland-Smith, A.J. | Deposition date: | 2025-02-16 |
|
PDBID: | 9ncg | Status: | HPUB -- hold until publication | Title: | Marpharsen treated Treponema pallidum thioredoxin strain Nichols | Authors: | Carbone, V., Ronimus, R.S., Sutherland-Smith, A.J. | Deposition date: | 2025-02-16 |
|
PDBID: | 9ncj | Status: | HPUB -- hold until publication | Title: | Coiled-coil bundlemer nanotube, R3K (15 proto-filaments) | Authors: | Das, A., Conticello, V. | Deposition date: | 2025-02-16 |
|
PDBID: | 9ncl | Status: | HPUB -- hold until publication | Title: | Arsenic treated Treponema pallidum thioredoxin strain Nichols | Authors: | Carbone, V., Sutherland-Smith, A.J., Ronimus, R.S. | Deposition date: | 2025-02-16 |
|
PDBID: | 9ncd | Status: | HPUB -- hold until publication | Title: | Crystal structure of the peanut allergen Ara h 9 with bound Fab IGX-3103 and antiFab nanobody | Authors: | Pedersen, L.C., Mueller, G.A. | Deposition date: | 2025-02-15 |
|