| PDBID: | 9n2v | | Status: | HPUB -- hold until publication | | Title: | Designed anti-OSM Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Watkins, A.M., Seeger, F., Frey, N.C., Bonneau, R., Regev, A., Hofmann, J.L., Gligorijevic, V. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i61 | | Status: | HPUB -- hold until publication | | Title: | Transient activated state of BetP in complex with betaine | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i66 | | Status: | HPUB -- hold until publication | | Title: | Downregulated state of the betaine transporter BetP | | Authors: | Heinz, V., Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i5y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ADP-bound BiP ATPase domain in complex with CDNF C-terminal domain | | Authors: | Fudo, S., Shpironok, O., Saarma, M., Kajander, T. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i60 | | Status: | HPUB -- hold until publication | | Title: | Transient activated state of BetP | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i5z | | Status: | HPUB -- hold until publication | | Title: | Upregulated state of BetP in potassium | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Horn, G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i5f | | Status: | HPUB -- hold until publication | | Title: | Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) NAD holoenzyme, from Helicobacter pylori | | Authors: | Foster, S.P., Moody, P.C.E. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9i5e | | Status: | HPUB -- hold until publication | | Title: | A Coiled Coil Module Strategy for High-Resolution Cryo-EM Structures of Small Proteins for Drug Discovery | | Authors: | Samson, C., Dossou, I., Steinmetz, A., Kumar, A., Mathieu, M., Rak, A. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9n20 | | Status: | HPUB -- hold until publication | | Title: | Structure of C3d Bound to a Fragment of FHR-2 and S. aureus Efb-C | | Authors: | Duan, H., Geisbrecht, B.V. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9lpv | | Status: | HPUB -- hold until publication | | Title: | Neutron structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at room temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpx | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at room temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpy | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of GH1 beta-glucosidase Td2F2 2F-Glc complex at cryogenic temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lpi | | Status: | HPUB -- hold until publication | | Title: | Neutron structure of GH1 beta-glucosidase Td2F2 glucose complex at room temperature | | Authors: | Yano, N., Arakawa, H., Lin, C.C., Ishiwata, A., Tanaka, K., Kusaka, K., Fushinobu, S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9lp2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced heterodimer dAID23.4 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9mzv | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9i3j | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CP of empty RHDV Cr | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9i3h | | Status: | HPUB -- hold until publication | | Title: | CP of RHDV mutant - N15 | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9i3k | | Status: | HPUB -- hold until publication | | Title: | Asymmetric cryo-EM reconstruction of the full-length E. coli transmembrane formate transporter FocA | | Authors: | Tueting, C., Janson, K., Kyrilis, F.L., Hamdi, F., Kastritis, P.L. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lnt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced homotrimer mAIT03 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9lns | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced homotrimer dAIT17 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9lo8 | | Status: | HPUB -- hold until publication | | Title: | Twenty-two polymer Msp1 from S.cerevisiae(with a catalytic dead mutation) in complex with an unknown peptide substrate | | Authors: | Chengdong, H., Simin, W., Xuan, C. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9mzc | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-22 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGRSMKLSCAASGFIFSNYGMAWVRQAPKKGLEWVAYINYDGGTTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTTGYYYDGSYYYDRFVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
>Entity 2
DIQMTQSPSFLSASEGERVTLNCRASQNINKYLDWYQQKLGEAPKLLIYNTNNLHTGIPSRFSGSGSGTDYTITISSLQPEDVATYFCLQRNSWYTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 9i3e | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CP of RHDV mutant - 29N | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3b | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 8s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3c | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 10s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 |
|
