| PDBID: | 8qgo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8w7r | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | H. walsbyi bacteriorhodopsin mutant - W94F | | Authors: | Li, G.Y., Chen, J.C., Yang, C.S. | | Deposition date: | 2023-08-31 | | Release date: | 2024-08-31 |
|
| PDBID: | 8w6w | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of C-terminal domain of nucleocapsid protein from SARS-CoV-2 in complex with ampicillin | | Authors: | Dhaka, P., Mahto, J.K., Tomar, S., Kumar, P. | | Deposition date: | 2023-08-30 | | Release date: | 2025-02-28 |
|
| PDBID: | 8tt8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Joint Xray/Neutron structure of Macrophage Migration Inhibitory Factor (MIF) Bound to 4-hydroxyphenylpyruvate at room temperature | | Authors: | Schroder, G.C., Meilleur, F., Crichlow, G.V., Lolis, E.J. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8q5c | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 12 (1075475) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 8tm8 | | Status: | HPUB -- hold until publication | | Title: | Monomer structure of monellin loop1 mutant (YENKG) | | Authors: | Manjula, R., Pavithra, G.C., Ramaswamy, S., Gosavi, S. | | Deposition date: | 2023-07-28 |
|
| PDBID: | 8tio | | Status: | HPUB -- hold until publication | | Title: | Human ACKR3 with C tail extended by 12 glycines phosphorylated by GRK5 in complex with Arrestin2 reconstructed without receptor/micelle | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 8pvy | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human BRISC dimer complex bound to compound FX-171-C | | Authors: | Chandler, F., Zeqiraj, E. | | Deposition date: | 2023-07-18 | | Release date: | 2025-01-18 |
|
| PDBID: | 8pru | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Engineered form of T thermophiles AHIR | | Authors: | Roberts, M., Powell, A., Lewis, C., Sinclair, J. | | Deposition date: | 2023-07-12 |
|
| PDBID: | 8tg0 | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of the cold shock domain of the Arabidopsis thaliana glycine-rich protein AtGRP2 | | Authors: | Pougy, K.C., Almeida, F.C.L., Pinheiro, A.S. | | Deposition date: | 2023-07-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 8jzp | | Status: | HOLD -- hold until a certain date | | Title: | Structure of mouse C5a-human C5aR1-Go complex | | Authors: | Yadav, M.K., Yadav, R., Maharana, J., Sarma, P., Banerjee, R., Shukla, A.K., Gati, C. | | Deposition date: | 2023-07-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 8pnf | | Status: | HPUB -- hold until publication | | Title: | HRV B14 virion proteins | | Authors: | Gil-Cantero, D., Mata, C.P., Mateu, M.G., Caston, J.R. | | Deposition date: | 2023-06-30 | | Release date: | 2024-12-30 |
|
| PDBID: | 8tbc | | Status: | HPUB -- hold until publication | | Title: | Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg | | Authors: | Abhiraman, G.C., Jude, K.M., Garcia, K.C. | | Deposition date: | 2023-06-28 | | Release date: | 2024-12-28 |
|
| PDBID: | 8phm | | Status: | HPUB -- hold until publication | | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | | Deposition date: | 2023-06-20 | | Release date: | 2024-12-20 | | Sequence: | >Entity 1
NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8t68 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of the SET Domain of Human Histone-Lysine N-Methyltransferase SUV420H1 in complex with RQ3-111 | | Authors: | Zeng, H., Dong, A., Brown, P.J., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-06-15 |
|
| PDBID: | 8jqi | | Status: | HPUB -- hold until publication | | Title: | Cryo EM map of full length PLC gamma 2 and FGFR1 Kinase Domain | | Authors: | Shin, Y.-C., Liao, M. | | Deposition date: | 2023-06-14 | | Release date: | 2024-12-14 |
|
| PDBID: | 8jq0 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of ZBTB48 ZF10-11-C in complex with CIITA promoter | | Authors: | Li, F.D., Wang, S.M. | | Deposition date: | 2023-06-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 8pa0 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex | | Authors: | Wang, Z., Benesch, J.L.P., Allison, T.M., Song, H., McDonough, M.A., Brem, J., Rabe, P. | | Deposition date: | 2023-06-06 |
|
| PDBID: | 8p9a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 80S yeast ribosome in complex with Methyllissoclimide | | Authors: | Terrosu, S., Yusupov, M., Vanderwal, C. | | Deposition date: | 2023-06-05 |
|
| PDBID: | 8p8w | | Status: | HPUB -- hold until publication | | Title: | Mycoplasma pneumoniae di-ribosome in chloramphenicol-treated cells (following 70S) | | Authors: | Schacherl, M., Xue, L., Spahn, C.M.T., Mahamid, J. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-02 |
|
| PDBID: | 8p8v | | Status: | HPUB -- hold until publication | | Title: | Mycoplasma pneumoniae di-ribosome in chloramphenicol-treated cells (leading 70S) | | Authors: | Schacherl, M., Xue, L., Spahn, C.M.T., Mahamid, J. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-02 |
|
| PDBID: | 8jl2 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SE_A277 variant at pH 9.5 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8jl6 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SEA227D variant at pH 5.5 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8jll | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SEA227D variant at pH 9.5 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8jlm | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SET203EF223DA227 variant at pH 4.5 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
