Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9i3j
Status:WAIT -- processing started, waiting for author input to continue processing
Title:CP of empty RHDV Cr
Authors:Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R.
Deposition date:2025-01-23
PDBID:9lnt
Status:HPUB -- hold until publication
Title:Crystal structure of de novo designed amantadine induced homotrimer mAIT03
Authors:Qihan, J., Longxing, C.
Deposition date:2025-01-22
PDBID:9lns
Status:HPUB -- hold until publication
Title:Crystal structure of de novo designed amantadine induced homotrimer dAIT17
Authors:Qihan, J., Longxing, C.
Deposition date:2025-01-22
PDBID:9lo8
Status:HPUB -- hold until publication
Title:Twenty-two polymer Msp1 from S.cerevisiae(with a catalytic dead mutation) in complex with an unknown peptide substrate
Authors:Chengdong, H., Simin, W., Xuan, C.
Deposition date:2025-01-22
PDBID:9mzc
Status:HPUB -- hold until publication
Title:anti-IL6 designed Fab
Authors:Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R.
Deposition date:2025-01-22
Sequence:

>Entity 1


EVQLVESGGGLVQPGRSMKLSCAASGFIFSNYGMAWVRQAPKKGLEWVAYINYDGGTTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTTGYYYDGSYYYDRFVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

>Entity 2


DIQMTQSPSFLSASEGERVTLNCRASQNINKYLDWYQQKLGEAPKLLIYNTNNLHTGIPSRFSGSGSGTDYTITISSLQPEDVATYFCLQRNSWYTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
PDBID:9i38
Status:HPUB -- hold until publication
Title:Solution structure of the de novo designed monoheme protein m4D2 with bound iron(III) 2,4-dimethyldeuteroporphyrin IX
Authors:Williams, C., Hutchins, G.H., Molinaro, P.M., Berrones-Reyes, J.C., Lichtenstein, B.R., Koder, R.L., Anderson, J.L.R.
Deposition date:2025-01-22
PDBID:9i3d
Status:HPUB -- hold until publication
Title:Isopenicillin N synthase co-crystallised with Fe and ACdV after 10s O2 exposure
Authors:Rabe, P., Schofield, C.J.
Deposition date:2025-01-22
PDBID:9i3a
Status:HPUB -- hold until publication
Title:Isopenicillin N synthase co-crystallised with Fe and ACdV after 6s O2 exposure
Authors:Rabe, P., Schofield, C.J.
Deposition date:2025-01-22
PDBID:9i3e
Status:WAIT -- processing started, waiting for author input to continue processing
Title:CP of RHDV mutant - 29N
Authors:Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J.
Deposition date:2025-01-22
PDBID:9i3b
Status:HPUB -- hold until publication
Title:Isopenicillin N synthase co-crystallised with Fe and ACdV after 8s O2 exposure
Authors:Rabe, P., Schofield, C.J.
Deposition date:2025-01-22
PDBID:9i3c
Status:HPUB -- hold until publication
Title:Isopenicillin N synthase co-crystallised with Fe and ACdV after 10s O2 exposure
Authors:Rabe, P., Schofield, C.J.
Deposition date:2025-01-22
PDBID:9ln7
Status:HPUB -- hold until publication
Title:Alpha-7 nicotinic acetylcholine receptor bound to inhibitory bicyclic peptide KP2007 in a resting state.
Authors:Chen, H., Sun, D., Tian, C.
Deposition date:2025-01-20
PDBID:9lmh
Status:HPUB -- hold until publication
Title:Crystal structure of LooH in complex with FAD
Authors:Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z.
Deposition date:2025-01-19
PDBID:9lmi
Status:HPUB -- hold until publication
Title:Crystal structure of LooH in complex with Trp
Authors:Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z.
Deposition date:2025-01-19
PDBID:9lmg
Status:HPUB -- hold until publication
Title:Crystal structure of LooH
Authors:Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z.
Deposition date:2025-01-19
PDBID:9lmj
Status:HPUB -- hold until publication
Title:Crystal structure of LooH in complex with I-Trp
Authors:Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z.
Deposition date:2025-01-19
PDBID:9lm7
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structrue of wuRFP-Pr1-88.
Authors:Guangming, D., Zehui, X., Longxing, C.
Deposition date:2025-01-18
PDBID:9lm6
Status:HOLD -- hold until a certain date
Title:Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 1D8
Authors:Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S.
Deposition date:2025-01-18
Release date:2026-01-18
PDBID:9lm5
Status:HOLD -- hold until a certain date
Title:Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 2A5
Authors:Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S.
Deposition date:2025-01-18
Release date:2026-01-18
PDBID:9lmd
Status:HPUB -- hold until publication
Title:Solution NMR structure of the lasso peptide actinosynnelassin
Authors:Chunyang, C., Yu, W.
Deposition date:2025-01-18
PDBID:9lm4
Status:HOLD -- hold until a certain date
Title:Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 2A5
Authors:Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S.
Deposition date:2025-01-18
Release date:2026-01-18
PDBID:9lm8
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of wuRFP-Pfr21
Authors:Guangming, D., Zehui, X., Longxing, C.
Deposition date:2025-01-18
PDBID:9lm9
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of wuRFP-Pfr16-v34
Authors:Guangming, D., Zehui, X., Longxing, C.
Deposition date:2025-01-18
PDBID:9llm
Status:HPUB -- hold until publication
Title:Structure of C-Terminal of AB40 Peptide containing GXXXG Motif in SDS Micelles
Authors:Sarkar, D., Bhunia, A.
Deposition date:2025-01-17
PDBID:9lkr
Status:HPUB -- hold until publication
Title:Crystal Structure of the bromodomain of human BRD9 in complex with the inhibitor Y22076
Authors:Chen, Z., Zhang, C., Xu, H., Wu, X., Zhang, Y., Xu, Y.
Deposition date:2025-01-16

242842

PDB entries from 2025-10-08

PDB statisticsPDBj update infoContact PDBjnumon