| PDBID: | 9nh5 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HUMAN U7 SNRNP WITH METHYLATED noncleavable H2A* SUBSTRATE PRE-MRNA (core region) | | Authors: | Desotell, A., Tong, L. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nh6 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HUMAN U7 SNRNP WITH METHYLATED noncleavable mH2A* SUBSTRATE PRE-MRNA (COMPOSITE MAP) | | Authors: | Desotell, A., Tong, L. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9q8b | | Status: | HPUB -- hold until publication | | Title: | Ligand binding domain of the PacG chemoreceptor from Pectobacterium atrosepticum | | Authors: | Gavira, J.A., Genova, R., Matilla, M.A., Krell, T. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9q8e | | Status: | HPUB -- hold until publication | | Title: | Dimeric crystallization of the ligand binding domain of the PacG chemoreceptor from Pectobacterium atrosepticum | | Authors: | Gavira, J.A., Genova, R., Matilla, M.A., Krell, T. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nh3 | | Status: | PROC -- to be processed | | Title: | Helicobacter pylori strain SS1 KatA | | Authors: | Baylink, A. | | Deposition date: | 2025-02-23 |
|
| PDBID: | 9m01 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the SLA-1*0808 allele and ASFV antigenic peptide at 1.8 A resolution | | Authors: | Wang, S., Zhang, N. | | Deposition date: | 2025-02-23 |
|
| PDBID: | 9ngk | | Status: | HPUB -- hold until publication | | Title: | Nanotube of Y5 - (4 protofilament) | | Authors: | Das, A., Conticello, V.P. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9ngo | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HUMAN U7 SNRNP WITH METHYLATED noncleavable mH2A* SUBSTRATE PRE-MRNA (FOCUS MAP) | | Authors: | Desotell, A., Tong, L. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9q86 | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 9.5 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-02-22 |
|
| PDBID: | 9nfn | | Status: | HPUB -- hold until publication | | Title: | Nanotube of Y5 - (5 protomer) | | Authors: | Das, A., Conticello, V. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9nfs | | Status: | HPUB -- hold until publication | | Title: | Structure of J-PKAc chimera in complex with Aplithianine j1 | | Authors: | Martinez Fiesco, J.A., Zhang, P. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9ng1 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of FabG4 from Pseudomonas putida KT2440 | | Authors: | Andrzejewski, S.J., Friedman, A.J., Mains, K., Thompson, A., Sankaran, B., Zwart, P.H., Shirts, M.R., Fox, J.M. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9ihh | | Status: | HPUB -- hold until publication | | Title: | Ex vivo spore-silk A-ENA fibers | | Authors: | Sleutel, M., Sogues, A., Remaut, H. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9ihj | | Status: | HPUB -- hold until publication | | Title: | Recombinant spore-silk A-ENA fibers | | Authors: | Sleutel, M., Sogues, A., Remaut, H. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9q82 | | Status: | HPUB -- hold until publication | | Title: | Recombinant spore-silk A-ENA-1 fibers | | Authors: | Sleutel, M., Sogues, A., Remaut, H. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz8 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 22-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz9 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 25-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lza | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 25-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzb | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 50-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lzc | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with long-a-axis diffraction data by mix-and-inject serial crystallography at 50-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 |
|
| PDBID: | 9lz7 | | Status: | HPUB -- hold until publication | | Title: | Reductive-half reaction intermediate of copper amine oxidase from Arthrobacter globiformis captured with short-a-axis diffraction data by mix-and-inject serial crystallography at 22-ms time delay | | Authors: | Murakawa, T., Okajima, T. | | Deposition date: | 2025-02-21 | | Sequence: | >Entity 1
ASPFRLASAGEISEVQGILRTAGLLGPEKRIAYLGVLDPARGAGSEAEDRRFRVFIHDVSGARPQEVTVSVTNGTVISAVELDTAATGELPVLEEEFEVVEQLLATDERWLKALAARNLDVSKVRVAPLSAGVFEYAEERGRRILRGLAFVQDFPEDSAWAHPVDGLVAYVDVVSKEVTRVIDTGVFPVPAEHGNYTDPELTGPLRTTQKPISITQPEGPSFTVTGGNHIEWEKWSLDVGFDVREGVVLHNIAFRDGDRLRPIINRASIAEMVVPYGDPSPIRSWQNYFDTGEYLVGQYANSLELGCDCLGDITYLSPVISDAFGNPREIRNGICMHEEDWGILAKHSDLWSGINYTRRNRRMVISFFTTIGN(2TY)DYGFYWYLYLDGTIEFEAKATGVVFTSAFPEGGSDNISQLAPGLGAPFHQHIFSARLDMAIDGFTNRVEEEDVVRQTMGPGNERGNAFSRKRTVLTRESEAVREADARTGRTWIISNPESKNRLNEPVGYKLHAHNQPTLLADPGSSIARRAAFATKDLWVTRYADDERYPTGDFVNQHSGGAGLPSYIAQDRDIDGQDIVVWHTFGLTHFPRVEDWPIMPVDTVGFKLRPEGFFDRSPVLDVPAN
|
|
| PDBID: | 9nf2 | | Status: | HPUB -- hold until publication | | Title: | KRAS G12D Mutant KRAS 1-169 at 298 K bound to MRTX-1133 and GMPPNP | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Aplin, C., Cerione, R.A. | | Deposition date: | 2025-02-20 |
|
| PDBID: | 9igt | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Assembly intermediate of human mitochondrial ribosome small subunit bound to METTL15, RBFA, and mtIF2 (State M2.1) | | Authors: | Khawaja, A., Singh, V., Shiriaev, D.I., Rorbach, J. | | Deposition date: | 2025-02-20 |
|
| PDBID: | 9igy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a Chimeric Protein Composed of the SNX5 PhoX Domain and the N-terminal domain of NCOA7-AS,crystal form II | | Authors: | Arnaud-Arnould, M., Rebendenne, A., Tauziet, M., Urbach, S., El Koulali, K., Ricci, E., Wencker, M., Moncorge, O., Blaise, M., Goujon, C. | | Deposition date: | 2025-02-20 |
|
| PDBID: | 9igu | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Assembly intermediate of human mitochondrial ribosome small subunit bound to METTL15 and RBFA (Inward conformation) (State M2) | | Authors: | Khawaja, A., Singh, V., Shiriaev, D.I., Rorbach, J. | | Deposition date: | 2025-02-20 |
|
