| PDBID: | 8u7p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-15 | | Release date: | 2025-03-14 |
|
| PDBID: | 8u7s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-15 | | Release date: | 2025-03-14 |
|
| PDBID: | 8wde | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-15 | | Release date: | 2025-03-26 |
|
| PDBID: | 8u79 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Substrate Binding Protein of Thermus thermophilus TAXI-TRAP protein with L-glutamate | | Authors: | Antony, I.R., Currie, M., Dobson, R. | | Deposition date: | 2023-09-14 |
|
| PDBID: | 8u6z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 | | Release date: | 2025-03-14 |
|
| PDBID: | 8u71 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 | | Release date: | 2025-03-14 |
|
| PDBID: | 8u73 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 | | Release date: | 2025-03-13 |
|
| PDBID: | 8u75 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-14 | | Release date: | 2025-03-13 |
|
| PDBID: | 8wcy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-14 | | Release date: | 2025-03-14 |
|
| PDBID: | 8wcw | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-14 | | Release date: | 2025-03-14 |
|
| PDBID: | 8wcx | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-14 | | Release date: | 2025-03-14 |
|
| PDBID: | 8wcz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-14 | | Release date: | 2025-03-14 |
|
| PDBID: | 8qju | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 | | Release date: | 2025-03-13 |
|
| PDBID: | 8qj1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-12 | | Release date: | 2025-03-18 |
|
| PDBID: | 8qiz | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of Paradendryphiella salina PL7C alginate lyase mutant H124 soaked with with penta-mannuronic acid | | Authors: | Wilkens, C. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qie | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME : LM32Cs1C1 mutant snoRNA overexpression, class 4 | | Authors: | Rajan, K.S., Yonath, A., Bashan, A. | | Deposition date: | 2023-09-12 | | Release date: | 2024-12-09 |
|
| PDBID: | 8u5i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of human IDO1 bound to Compound 23 | | Authors: | Steinbacher, S., Lammens, A., Harris, S.F. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8u52 | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of human transthyretin conjugated to the stilbene substructure derived from reaction with the fluorogenic covalent kinetic stabilizer A2 | | Authors: | Yan, N.L., Nugroho, K., Kline, G.M., Basanta, B., Lander, G.C., Wilson, I.A., Kelly, J.W. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8wc2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 | | Release date: | 2025-03-11 |
|
| PDBID: | 8qht | | Status: | HPUB -- hold until publication | | Title: | Leishmania braziliensis PRMT1-PRMT3 heterotetrameric complex in unliganded form. | | Authors: | Levdikov, V., Nay, E., Walrad, P., Plevin, J.M. | | Deposition date: | 2023-09-10 | | Release date: | 2025-03-10 | | Sequence: | >Entity 1
DYYFDSYSHYGIHMEMLKDYHRTTTYRDAIWRNAYMFKDKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARQIVQDNGFSDIITIIQGKVEELDLDEKVDIIISEWMGYFLLYESMLNTVLYARDRWGASDVKILPSSANMYACGITDPQYVEQKFNIWNSVNGLDFSYFKRLSYIEPLIDTVNPEQIITDIVPFFSFDINRVTEAELSFTSTFTLEAKQGDFVHAISVHFDTPFYAGHDPVVLNTSPMVPPTHWRQTVLYMFHPLIMKRGEKANFTMKCAPNPGNPRDLDISLHIDFDGELQACHYDQDFRLR
>Entity 2
SAARISSNISTIHDHQRLRAYEVIFRNVRGKTLLHLGCGMGLYSMLAARGMAKMVIGIDSSAIVDAARVVAEQNGLKNIQFIRGRLCEALHQLPSDMKFDYVLCEWMGPLLLNERVLTDALYARDHLLTESGALCPNRASLHVVAVSDYAFRLDTEDFWSNVYGFQMEPMKELVRQEVEMCAIPGSNIVSAPCLAHTIHMDTLEGLTAEETATYEAQANQAAAIRDNEEENPVEHCWVPAAVAQKGYEAAFTLSIARSATVHYLTFYLDAAFTSKTNPGANFVLAVRPGGQNNWTEVSVGLREPLPVNAGEKIQGTVRVYTPAEKGGKVTVVEVTAKTAGQVAAIETFGTYYYQSY
|
|
| PDBID: | 8qhu | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME : LM32Cs1C1 snoRNA overexpression | | Authors: | Rajan, K.S., Yonath, A., Bashan, A. | | Deposition date: | 2023-09-10 | | Release date: | 2024-12-09 |
|
| PDBID: | 8u4g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 | | Release date: | 2025-03-10 |
|
| PDBID: | 8u4m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 | | Release date: | 2025-03-10 |
|
| PDBID: | 8wbw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 | | Release date: | 2025-03-10 |
|
| PDBID: | 8wbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-09 | | Release date: | 2025-03-10 |
|
